Dbfetch

LOCUS       NM_074449               2400 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Dipeptidyl peptidase family member 1
            (dpf-1), partial mRNA.
ACCESSION   NM_074449
VERSION     NM_074449.3
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 2400)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 2400)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2400)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 2400)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            On Jun 26, 2012 this sequence version replaced NM_074449.2.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..2400
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            <1..>2400
                     /gene="dpf-1"
                     /locus_tag="CELE_T23F1.7"
                     /db_xref="GeneID:180042"
                     /db_xref="WormBase:WBGene00001054"
     CDS             1..2400
                     /gene="dpf-1"
                     /locus_tag="CELE_T23F1.7"
                     /standard_name="T23F1.7b"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Dipeptidyl peptidase family member 1"
                     /protein_id="NP_506850.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00001054"
                     /db_xref="EnsemblGenomes-Tr:T23F1.7b"
                     /db_xref="GeneID:180042"
                     /db_xref="WormBase:WBGene00001054"
                     /translation="MTAEADLLEGYDEELGGNESQKRDCKGITTAIVVVLLILVMIFA
                     ALVFFTPLFAAKSFGSWRLNVSDLRSLRYPYAEFAFTDNNAVVMQSWEGVEIVEDGVS
                     RLIFGRENGAEITPSADRKYFAMMDHAPNPGMNPQNETFHLKIVNNNERLNPLLPFEV
                     EELFRELSDSRITYDIGLRKEESVIQAFKWNGKFNDFVFVESNKIYYQSSPEEEGLTR
                     VSNGGEHTVDGLFDWIYEEEIFGRKDAMWWSTKGDQLAYASYDNHLTKNVSLKTYHRL
                     EPYPIDTNFHYPKTFAKVLPTYTLSIWNKKTEQSRQLDVQLKDSLSYHYLLAVKWLEI
                     NGTEQLVSVWTNRYQNEVALTICDWDTAICRLEFEYKYASKRWVTHDDFHSITSFEDT
                     LFFLLPHDKRDNAFQQVASLRLSHGQLRTPKFLNLGEYDVTSINGINKETRTIFFHAA
                     APKPSHRSLFSYSLADESRNSAYCISCSIKNCTWAQAQMDDQMKTAIVSCKGPAAPHT
                     AIVNLTRMDSDKKTEHANLLYDKTYQNRVEEAGLPVIIKETIKISDDFDALIKLSIPK
                     DIYNRDKHQAIPLIVHVYGGPNDQNTKEATQIGIEEVVASASQAAILRIDGRGSGGRG
                     WKYRSAIYGQLGTVEVEDQIKAIKVVLRLYRHLLDARRVAVFGWSYGGFMTLSMVNEA
                     PEQFFKCAVSVAPVTNFAYYDATYTERYMGDAPLESYSDVTKKLDNFKSTRLLLMHGL
                     LDDNVHFQNSAILIDELQNRGVDFDLMVYPNQAHSLSSRTSHVVGKMTHFLRQCFYTD
                     K"
     STS             1490..2254
                     /gene="dpf-1"
                     /locus_tag="CELE_T23F1.7"
                     /standard_name="T23F1.7"
                     /db_xref="UniSTS:308088"
ORIGIN      
        1 atgacagccg aggcggatct gttagaggga tatgatgagg agctcggcgg aaacgagtct
       61 caaaaacgtg actgtaaggg catcaccacc gctatagtcg tggtgctcct catattggta
      121 atgatattcg cagcgctggt attcttcaca ccactttttg ctgctaaatc atttggatcg
      181 tggcggttga acgtttctga tctacgatcg ctacgatatc catatgccga attcgcgttt
      241 accgataaca atgctgttgt tatgcaaagt tgggaaggtg tggaaattgt cgaagatgga
      301 gtatccagac tgatttttgg aagagaaaat ggggccgaga tcacgccgtc cgcagatcgg
      361 aagtattttg ctatgatgga tcacgcgccg aatccgggaa tgaatccgca gaacgagacg
      421 tttcatttga aaattgtgaa caataatgag aggttgaatc ccctgttacc ctttgaggtt
      481 gaagaacttt tccgtgaact ttcggattcc agaatcacat acgacattgg cctccgcaag
      541 gaagagtccg tgattcaggc gttcaagtgg aatgggaagt tcaatgattt tgttttcgtt
      601 gaaagtaata aaatctacta ccaaagtagt cctgaagaag aaggcttgac tcgtgtgagc
      661 aatggaggtg aacacacagt cgacggactt tttgattgga tctacgagga ggaaatattc
      721 ggaagaaagg atgcaatgtg gtggtcaaca aaaggagatc aactcgcata tgcttcatat
      781 gacaaccatc ttacaaagaa tgtctccttg aaaacctacc accgtctaga gccctaccca
      841 attgacacaa atttccacta cccgaaaacc tttgcaaaag tcttgccaac ttatacgctt
      901 tcgatatgga acaagaaaac ggaacaatcc aggcagttag atgttcagtt gaaggatagt
      961 ctgtcctatc attatttgct ggcagtgaag tggttggaga ttaatggaac agagcaattg
     1021 gtgtcggtat ggacaaatcg gtaccaaaat gaggtggcgt tgacgatttg tgactgggac
     1081 actgcgattt gtcgtttgga atttgaatac aaatatgcct caaaacgatg ggtaactcat
     1141 gatgatttcc actcgatcac ctcattcgag gacactctct tcttccttct tccacatgac
     1201 aaacgtgaca atgccttcca acaagttgca tctcttcgac tctcacatgg acaacttaga
     1261 actccgaagt tcctgaacct cggtgaatac gatgtcacat caatcaacgg tatcaataaa
     1321 gaaaccagaa caattttttt ccacgcagcc gcgccaaaac cttcccacag atcgcttttc
     1381 tcgtatagct tggccgatga atctcgaaac tcggcatatt gcatctcgtg ctctattaaa
     1441 aattgcacat gggctcaagc tcaaatggat gatcagatga aaacggcaat tgtttcatgc
     1501 aaaggaccag ctgcgcccca tacagcaata gtgaacttga ctcgaatgga cagtgacaaa
     1561 aaaacagagc atgcgaatct cctctacgac aaaacctatc aaaatcgtgt agaagaagct
     1621 ggtcttccgg tgattatcaa agagactatc aaaatttctg atgactttga tgcccttatc
     1681 aagctctcaa ttccaaaaga catttacaac cgagacaaac atcaggcaat accgttgatt
     1741 gttcatgtat acggaggacc taacgatcag aacacgaagg aggcgactca aattggaatc
     1801 gaagaagttg tggcttcagc gtcacaagcc gccattttaa ggattgatgg aagaggaagt
     1861 ggtggacgag gatggaagta tagatcagca atttatgggc agttgggaac ggtggaggtg
     1921 gaggatcaga ttaaagctat caaagttgtc ctccgtctct accgtcactt attagatgct
     1981 cgccgagttg ccgtttttgg ctggtcctat ggcggtttta tgacgctctc catggtcaat
     2041 gaagctccag agcagttctt caagtgcgca gtttcagtgg cgccagtcac taattttgca
     2101 tattatgatg caacctacac tgaaagatat atgggtgatg caccgttaga gtcgtacagc
     2161 gatgtgacta agaaattgga caacttcaaa tctacacgac ttcttctgat gcatgggctt
     2221 ctggatgaca atgtgcactt ccaaaacagt gcaatcctaa ttgatgagct acaaaatcgg
     2281 ggagtcgatt ttgacttgat ggtctaccca aatcaagcgc attccctgtc cagtcggacg
     2341 tctcatgtcg ttggaaaaat gacacatttc cttagacaat gtttttacac tgataagtag
//