Dbfetch

LOCUS       NM_071921                966 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Serpentine Receptor, class H (srh-23),
            partial mRNA.
ACCESSION   NM_071921
VERSION     NM_071921.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 966)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 966)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 966)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 966)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..966
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            <1..>966
                     /gene="srh-23"
                     /locus_tag="CELE_C02E7.5"
                     /db_xref="GeneID:191849"
                     /db_xref="WormBase:WBGene00005248"
     CDS             1..966
                     /gene="srh-23"
                     /locus_tag="CELE_C02E7.5"
                     /standard_name="C02E7.5"
                     /note="Product from WormBase gene class srh;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Serpentine Receptor, class H"
                     /protein_id="NP_504322.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00005248"
                     /db_xref="EnsemblGenomes-Tr:C02E7.5"
                     /db_xref="GeneID:191849"
                     /db_xref="GOA:O16430"
                     /db_xref="InterPro:IPR019422"
                     /db_xref="UniProtKB/TrEMBL:O16430"
                     /db_xref="WormBase:WBGene00005248"
                     /translation="MDCLEPSPLIFRIFTHSIHFVSLPTYFLALFSLFFIKSKVFVTY
                     RYFLLWHVFENLFFEMHSDFLLAPAIQPPLCAIRTTGILTQLGMSSLVQFYWIALVMQ
                     YTATSVSEMFYFRYKASILNYKTYRFTYFIKFTVYFTRCISIFDTFFVILTSHDAHRF
                     QEEHKATFLKQNPSAHFLTCENSYLFVPFSDYVSTSIMILWIAECVIIFLSVPGITIF
                     INLKISKSTSKNTWKVQKQLLKSLVIQALIHSFTMGLPNLMFTYGFFFGYASETIAYG
                     AFVFITYHGFVSTFALIAFTKPIRDYLQSTFNIKKRATHRASMTF"
ORIGIN      
        1 atggactgcc ttgagccttc tccattaatt ttcagaattt tcacccactc gattcatttc
       61 gtcagcttac caacatattt tctcgcatta ttctccctct ttttcatcaa gtcaaaagtt
      121 tttgtcactt atcgatattt cctgttatgg catgtcttcg agaatttatt cttcgaaatg
      181 cattccgatt ttctgttggc accagcaatt cagcctccgt tatgtgcaat cagaacaaca
      241 gggattttga cacaactcgg aatgagtagt ttggttcagt tttattggat cgcgttggtt
      301 atgcaatata cagcgacttc tgtcagtgaa atgttttatt tccgttataa agccagtatt
      361 ctaaactaca aaacatatcg tttcacctat tttattaaat tcactgttta tttcactcga
      421 tgcatttcaa tttttgatac attttttgta atattgacat cgcatgatgc tcaccgattt
      481 caagaagaac acaaagcaac atttctgaaa caaaatcctt ctgctcattt tctaacttgt
      541 gaaaattctt atctgtttgt ccctttctcc gactacgttt ccacttcaat aatgattcta
      601 tggattgctg aatgcgtaat aatttttctc tctgttcctg gaatcactat ttttatcaac
      661 ttgaaaattt caaaatccac ctcgaaaaat acttggaaag tacaaaaaca attattgaaa
      721 agtttagtta tacaagcatt aattcattcg tttacgatgg gtctgccaaa tttgatgttt
      781 acatatggat ttttcttcgg ttatgcaagc gaaacaatag cgtatggtgc atttgtcttc
      841 ataacatatc atggatttgt ttcaactttt gcacttatcg cattcactaa gcctatacgc
      901 gattatctgc aatcaacatt caatattaag aaaagagcca ctcatagagc atcaatgact
      961 ttttag
//