Dbfetch

LOCUS       NM_071609                993 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Serpentine Receptor, class H (srh-213),
            partial mRNA.
ACCESSION   NM_071609
VERSION     NM_071609.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 993)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 993)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 993)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 993)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..993
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            <1..>993
                     /gene="srh-213"
                     /locus_tag="CELE_T22F3.5"
                     /db_xref="GeneID:188749"
                     /db_xref="WormBase:WBGene00005423"
     CDS             1..993
                     /gene="srh-213"
                     /locus_tag="CELE_T22F3.5"
                     /standard_name="T22F3.5"
                     /note="Product from WormBase gene class srh;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Serpentine Receptor, class H"
                     /protein_id="NP_504010.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00005423"
                     /db_xref="EnsemblGenomes-Tr:T22F3.5"
                     /db_xref="GeneID:188749"
                     /db_xref="GOA:Q94302"
                     /db_xref="InterPro:IPR019422"
                     /db_xref="UniProtKB/TrEMBL:Q94302"
                     /db_xref="WormBase:WBGene00005423"
                     /translation="MPHDFCTSTFYLYTADFQRLFLHYFGFVAIPVHVYGAYCIIFHT
                     PSSMKSVKLSLLNFHFLSCFFDLGLSFLTTPYILFPALAGYPLGVLKDFGVRNEHQLY
                     FMLVVGAYMLVTIILVFENRLLILIPTSKCWRVFRTPWFITHFIVATVFFFPAYQMIP
                     DQQLAKNFVISIAPCIPLYVNADLVFVMLLETRFFLRAAGVLILAGFMEIWIFAYVTD
                     RLLGQQINRTMSKRTVELHKKFQKAFLTQLTIPILILILPIIYIGVSCLVFYHNQAIN
                     NITVIIVSSHGFFSTIVMIYIHAPYREFTLRWLTVLTHVRLENQSSVVPSNNIT"
ORIGIN      
        1 atgccgcacg acttctgtac tagcactttc tacctgtata ccgcagattt tcaacgttta
       61 tttctccatt attttggttt tgtggcgatc ccggtgcacg tctacggtgc ctattgtatc
      121 attttccata ccccatcgtc catgaaatcc gtgaagctga gcctcttgaa ttttcacttt
      181 ttaagctgct ttttcgattt gggcctcagt tttttgacga caccttacat attgttccca
      241 gcactagctg gttatccatt gggtgtgttg aaggattttg gagtgaggaa tgagcatcag
      301 ttgtatttta tgcttgttgt tggagcttac atgctcgtca caatcattct cgtcttcgag
      361 aaccgtctac tcatcctcat cccgacgagc aaatgttggc gtgtatttcg aactccgtgg
      421 ttcatcacgc atttcatcgt tgcaacagtg ttctttttcc ccgcgtacca aatgatcccc
      481 gaccagcaac tcgcaaagaa ctttgtgata agcatagccc catgcattcc actttatgtg
      541 aatgctgacc tggtttttgt gatgctcctt gaaactcgat ttttcctccg agcagctggt
      601 gttctaattt tggcggggtt catggagatt tggatatttg catatgttac cgatagattg
      661 cttgggcaac agataaatcg gacaatgtcg aagaggacag tggagttgca caagaaattt
      721 caaaaagcat ttctgaccca gctaacaatc ccaattctta ttctcatcct gcccatcatc
      781 tatatcggtg tttcgtgcct agtcttctac cacaatcagg caatcaataa tattactgtg
      841 ataattgtgt catcccatgg tttcttctcg acaatcgtca tgatttacat acacgcaccg
      901 taccgcgagt ttacgcttcg atggctcacg gttttgacgc atgttcgatt ggaaaatcag
      961 agttcggtgg tgccgagtaa taatattaca tag
//