Dbfetch

LOCUS       NM_071357              12753 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans KETtiN (Drosophila actin-binding) homolog
            (ketn-1), partial mRNA.
ACCESSION   NM_071357
VERSION     NM_071357.9
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 12753)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 12753)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 12753)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 12753)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            On Apr 20, 2015 this sequence version replaced NM_071357.8.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..12753
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            <1..>12753
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /db_xref="GeneID:178740"
                     /db_xref="WormBase:WBGene00004130"
     CDS             1..12753
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /standard_name="F54E2.3a"
                     /note="Product from WormBase gene class ketn;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="KETtiN (Drosophila actin-binding) homolog"
                     /protein_id="NP_503758.5"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004130"
                     /db_xref="EnsemblGenomes-Tr:F54E2.3a"
                     /db_xref="GeneID:178740"
                     /db_xref="GOA:Q5PY59"
                     /db_xref="InterPro:IPR003598"
                     /db_xref="InterPro:IPR003599"
                     /db_xref="InterPro:IPR007110"
                     /db_xref="InterPro:IPR010939"
                     /db_xref="InterPro:IPR013098"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR036179"
                     /db_xref="UniProtKB/TrEMBL:Q5PY59"
                     /db_xref="WormBase:WBGene00004130"
                     /translation="MPVFRQQQPTQVTNGGIKAANGSAKTANGSANGSANGSAVHAAN
                     GGPSSQQARGHEHGAALVNARPPQFLVHPQSVAAKAFETVTFSAKVVGTPTPSLTWQK
                     SDGTVIQSGGKYKIENGPDGSGRLIIEKVDAHDADMYMLVARNDGGSFQSRFSLNVLQ
                     AKSPEAPEFTGKFQSTTLYDGDSVKLYCKAAGEGVSFKWFKDNEPISSGGSYAVDNKG
                     NETTLHINNATMKEGGWYRCDATNKHGTTTLKGRVVVNSRQKFNGPAHREMITLRKVD
                     KVERSRTPVNQLQDVSASKSSPKFEGSLQSQQLVEGQSARLEIKYTPVEDPNLRIAWL
                     LNGKGILASSRIVTFTDFGIAALEINPVNVFDQGEYTVVAVNPLGEARVSANIAVIGH
                     GSFIQQQQSGSQFGGTAYQSKGAQAPAGTHLDLPNFHSDLRSQEVFEGQQIHLETKLT
                     PINDPDLRVVWLLDGNELPSNDKYRQTLSHGFASLDIPQTSSNDSGLYSCRAFNKLGE
                     SENQATIIIVPKSDLQQFEQHRQLDVEDVREIQFAHSSQDLTPKFLSQIQPFHCEQEL
                     GRSFFEARIQPINDPTLRVSWLKDGQPLPNANRIQIFQNFGVVSLSLHPTYPEDAGVY
                     TCVLFNSHGQAQSSAELTTVWIDTLQLDSKHADSLPIIGYLDSHQIHIGPQSVERPEE
                     FNSLEAPKFARELAGKIEVMENERVHFEARILPANDVKMTVEWYHNGNPLPAAHRFHP
                     MFDFGYVALDLLYAYPQDSGTYTLVARNELGEARSNVELVVGTEKVLYLEPHHPEGLE
                     RIKELEQDRRQGIAEVEDRTCDAAPKFLNDLPDIQLNEHENIHVDLRATPVNDPTMVI
                     EWFVNGRPLLTGSRVKTLNEFGFIALDIKGAIAEDSGTYSVRASNLLGEAIRQCVITV
                     TPAGQILSDTQHQESLGKINYLENLNKYGRVEIEDKGPQEPPTFVVPLQADLGDVEEG
                     EPIHLECQVNPINDNSLKIIWLRDGQSLPHGHRFRTFYDFGFVSLDILGFYAQDAGTY
                     TCRAENSLGQAETVATIRCAPKDAILGAVQHPRSYARIQEIEAPKPAPQEVPDLPHQP
                     PAFVKQLGPAIQCMEGDNVYLEAQVTPTDDNSLTYEWLVNGQPLMKAHRFVLSQDFGY
                     IALNILYCYPEDNGTYTLVVRNRAGEAQSTVDINCGHTGGNFTDSFHPNSLHRIAELE
                     TPIQRAEPLPDKEKEVPTIAKPLPATIDSVHESQTLHLEAQVTPIDDNTLRYEWLFNG
                     NPLKASSRYRVLNDFGFVSLDIDYIIAEDSGKYTLVVYNSAGRAETSCEFQVDRLKSI
                     LSDTAHPESLRRIREMEQLQPAKPSDDDAAAQPPVFTQQLTGPTEPLKEGQSVHMDCV
                     VQPINDPSLRIEWFHDGRPLMFGSRIRTIHDFGYVGLEFLHIHPEDTGTYTCKATNLI
                     GEATTDIFLECKPRRNIYLDTHHESSWQKIQEIENRVDEREPTPELTFQPPTFTENLA
                     DKEDAQEGQSIRLECRLIPVNDPTMRVTWTRNGQPLPEASRFMPARNFDYVNLDILAL
                     YGEDSGVYTCKAVSAFGEAATSCTVKCAAGKSLLLDTMHDASWKRVQEIENREKLEAV
                     DAEPEKTAPKFVTQLNSSLGELQEGVPIHLEAQVEPTNDNQLTVQWFHNGQPLANGHR
                     FRTRHDFGYVALDILYAFAQDTGEWACVARNSLGEAQTIANFTVLPRGTIYTDSQHPE
                     SWQKIQVLEAPRAAAPEKPDAEHDAPQFIEPLDSIDRMEFQSAHFQTKVTPQTDPNLR
                     IQWFKDGQPLMNSNRFKLTTDFGYISLDIAHTVPEDSGVYSVKASNAKGDAEVQAQLT
                     VTGNAVILGDTQHEQSWQKIQLIEAPRAPGEEEPDVKHGPPKFVTQLHSLDGVVEGQP
                     SHFEAQFIPFSDPKTSVQWYLNGNPLSASSRRILRNDFGLVSLDLQYTLGEDAGEYSV
                     VVKNSEGEDRTSGQLSCTTRAAILGDTQHEQSWQRIQEIEAPRAPGAEPEGPVYEKPS
                     FVQPLQSVGDLPEGSVALLEARLVPVNDPNLRVQWFYNDQPLMESNWISTSNDFGCVS
                     LRIAPVYARHTGVYSCKAWNDSGNAVTSANVGVQGSEGLLLDTSHPASLQKIQELEAI
                     DKYARLDAPEREYEKPQWVQGFENYENVGEGQTVTLHGLVEPSGDPHLRLEWLLNGTP
                     LRNANRFRQEYEFGNAILTIVHVLPHDSGVYTCRAWNTQGEASTSATVTTAGYEKILY
                     DSQHPVSWERIQELEAPKIVEEIEEIVQKEKPNFLTQLESAENVPEGVPLHLESTFQP
                     ARDPELKVVWQKNGQPLGASQLVQTKHELGWATLDISSANEDHNGVYTLTITNSEGEA
                     VSTASIRVAGTGPILGNTRHEESWKRIQILEAPKEAEPEAPAPVYDHPAITTQIDDKE
                     CNEGDHVHFEALITPVNDPRLQVQWIRNGVPLAHGSKYAIQQDFGICTLDVAYTYPED
                     EGVYQLRIWNPEGEAVSSATLKCHGKDAILGDVQHQESWKRIQEIEAPKQKLEEADPE
                     PKGPPRFIQQLTSPGSLVENQPAHFEATVEPVDDPTLTINWFLNGEPMSASSRVKMIN
                     DFGWVIMDIAQTEPRDSGEWKCVAKNAAGEAVSTATIEVQGKEVILQDSLQPQSLDRI
                     RQIEAGKPAPEERPDQQFEAPAIVNALQVQGALEEGGSAHLQTQFTPVADPSIKVEWL
                     KDGQPIFHSNRYKMVHDFGFAVLDILHLLKHDAGEYTFRVSNNSGEASTSTSFEVSES
                     SGLILQPQNEQKAKAVEILEDNLRRRPEEIEQELKEATPVFIEPLSAPVETEEGGRAH
                     FTARYEPVNDNQLQVQWYHDGRPLKNGSRIKTINSFGYVVLEISPTYPEDNGEYICRA
                     VNRVGEAVTSTKLTCTPKEGIISATQLPERMANAGRRIAEIEAPRPAREDAPDADHGP
                     PKFTSALAGPPELQEGQQAHLECQVTPVADPRLVIEWFHNGQPVNHTNRMKAIHDFGF
                     VVLQLTPAEPQDSGTWTCRATNQHGSDEVSTELKVVGGGGVSYEWQSTAERKERITEL
                     EDWIHRPKEDLNLPAVDYPAPSFSQGLTDLGQLNEADATAFVCVLEPIGDPTLRVQWE
                     HNGHPIPYSNRISCTNEFGVATLLIKHLIAADAGEYKCVATNVKGSATSVGKIAVESS
                     TQIDAPQVVQQLVDSVENILEGDSIHLECRVTPINDPRLHVEWLRNGAPLPEASRFKP
                     TFEFGFVSLDILYAYPEDNGDYELVVRNDKGEARSKTKITVLPRPSLDYTSQTHGNQQ
                     DSLESHFKQHSQAKLQLTANDIYNESDKRAPEFRTQLQNIGVLEGEFCRFETQVAPIN
                     DPYLKVEWFKDKKPVLLGHRFRSTLDFGFACLDLLYALPDDTGEYHCVATNRHGQTMI
                     SAKLACQGASHVITDSQMPQGLRVSNVKKDNKNIYWSEQGGAVQPKQKQAPQFTIPLR
                     NLQVTENQPARFECAVTGYPRPKVTWFINGNQCLHGHRFKLNFDGLHYLTVSKSRISD
                     AGEVVAIARNTEGETISTATLDIFQNDDFRQTKLRPANFKTSDELRERELQWQRDTLG
                     SLGPAFEAAPKPDAQKLMHVERAQSPIEPMESQELIQKFTRPRDDNFYNKLSYVELQK
                     PQFKGMELEEVNLKAGKVEKYQPPVEEMERVNLKAIPEKDQQEVGWERPDWAGQDGTS
                     KLPGADEGRFKKLPTPAPELDVPARDQVKLKTAKPTRGKDLEAGEKVKLKTEKAKIKE
                     IQQKPEQPKEEPIVHKDAVQLKTQQLPKTGIKGDHFTVDREKDLKETPAVVKPVIEET
                     RISNKPQPTKIGQSKQAPPTISQQLKPLQGELGKAAKFVIEFAGAAPVKVTWLKDGKE
                     IKSTFRTLITTTPTNSSLHIGRLENSHAGEYTVRLENAAGTVESLANLTVAPPTTQGK
                     APDFSARLNDLRIQQNGPAEFSCQIGGEPKPTIQWFKDGQPLPNDDRFQVVEEGGAYK
                     LKFSNIISTDAGIYEIVAKNGVGEARCKARLNVNLQKTGKGAEEGPRYEAPRFTSQIQ
                     PIVVDEGKGAQFSAQFSGFPDPTIRWYRNNEPVKHADGYEISQSKGEAILRISAARNE
                     DVAEYKVEASNPAGKASSVANLVLTPRSGRIAKSTISRGGSASYQSSDKAAADSPHFI
                     AKLSDISARQGHTVKFSAEVDGNPEPTVQWQFKGKPISASNNVKISRDGKRAILELAR
                     VTPDSAGEYQIVIRNDKGAATSQAKLTLSR"
     STS             1857..2288
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /standard_name="R05D8.p"
                     /db_xref="UniSTS:324253"
     STS             4309..5491
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /standard_name="F54E2.3"
                     /db_xref="UniSTS:311783"
     STS             7256..8168
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /standard_name="R05D8.n"
                     /db_xref="UniSTS:322613"
     STS             8620..10310
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /standard_name="R05D8.m"
                     /db_xref="UniSTS:323579"
ORIGIN      
        1 atgccagtat tcagacagca gcaaccaacc caagtcacta acggaggaat caaagcagca
       61 aatggttccg caaaaactgc aaacgggtca gcaaacgggt cggcaaatgg atccgccgta
      121 cacgcagcaa acggcggacc atcatctcaa caagcacgcg ggcacgaaca cggagcagca
      181 ctcgtgaacg cccgtccccc acaattcctc gtccatccac agtccgtcgc agcaaaggcc
      241 tttgaaacag tgacattcag cgcaaaggtc gtcggaacac caactccgtc gctgacgtgg
      301 cagaagtccg acggaactgt tattcagtcg ggaggaaagt acaagatcga gaatgggcca
      361 gacggcagcg gtcggcttat tatcgagaaa gtggacgcac acgacgccga catgtacatg
      421 ttggtagcca gaaatgatgg aggatcgttc cagagcaggt tctcactgaa cgttcttcaa
      481 gctaagtcgc ctgaagctcc agaattcact ggaaagttcc agtcaacaac gctttacgac
      541 ggagattctg tgaagctcta ctgcaaagca gcaggagaag gagtgagctt caagtggttc
      601 aaggataatg aaccgatctc atcaggcggc agttatgccg tcgacaacaa aggcaacgag
      661 accacgttgc acatcaacaa tgccacaatg aaagaaggag gatggtaccg gtgcgatgca
      721 accaacaagc acggaacaac tactctgaag ggacgcgtcg tggtgaactc tcgacaaaag
      781 ttcaacgggc cggctcacag agaaatgatc acgctgagaa aagttgacaa ggttgaaaga
      841 tcgcgaacac cggtgaatca gcttcaagat gtttccgcat caaagtcgtc gccaaagttc
      901 gaaggatcac ttcaatcgca acaactcgtt gaaggacagt cggccagact tgaaatcaag
      961 tacacaccag tcgaagatcc gaatctcaga attgcgtggc tcctcaatgg aaagggtatt
     1021 ttggcctctt ccagaattgt gacctttacc gatttcggaa ttgcggcgct ggaaatcaac
     1081 ccagtcaatg tattcgatca aggagagtac actgtcgtcg cagtgaatcc acttggtgaa
     1141 gctcgagtct ctgcaaacat cgcggtcatc ggtcatggaa gcttcatcca acaacaacaa
     1201 tcaggaagcc aattcggagg aactgcctat caatcgaagg gtgcgcaagc tcctgctgga
     1261 actcatcttg atttgccgaa cttccattct gacttaagat ctcaagaagt ttttgaaggt
     1321 cagcaaatcc acttggagac aaagcttaca ccgatcaatg atcctgatct tcgagttgtg
     1381 tggcttctcg atggaaatga attgccaagc aatgacaaat accgtcaaac cctatctcat
     1441 ggattcgctt cactggatat accacaaacc tcaagcaatg atagcggact ctactcgtgc
     1501 cgcgcattca acaagctcgg agaatccgag aatcaggcca ctatcatcat tgtgccaaaa
     1561 tctgatctcc aacaattcga acaacatcgt caactcgatg ttgaggatgt tcgagagatt
     1621 cagttcgccc actcttctca agacctgacg ccaaagttcc tttctcaaat ccaaccattc
     1681 cattgcgaac aggaacttgg aagatcgttc tttgaagcga gaattcagcc gatcaacgat
     1741 ccaactcttc gggtgtcatg gcttaaggat ggtcaaccac tccccaacgc caatcgcatc
     1801 caaattttcc aaaactttgg agtcgtgtca ctctcgcttc atccaactta ccccgaagat
     1861 gctggagtct atacttgcgt acttttcaat tcgcatggac aagctcaatc atccgctgag
     1921 ctgacaacag tctggatcga cactctccag cttgactcca agcatgctga tagtcttcca
     1981 attattggct accttgacag tcatcaaatc catatcgggc cacaatctgt ggagcggcct
     2041 gaagagttca actccttgga ggctcccaag tttgctcgcg agcttgccgg caaaatcgaa
     2101 gtcatggaga acgagcgagt gcacttcgag gctagaatcc ttccagccaa cgatgtgaag
     2161 atgacagtgg agtggtacca caatggcaac ccgcttccag ctgctcatcg cttccaccca
     2221 atgtttgatt tcggctatgt tgctctggat ctgttgtacg cttatccaca agactctgga
     2281 acctacacat tggttgcgag aaatgaacta ggagaagctc gaagcaacgt ggagctggtt
     2341 gttggcactg agaaagtact ttatttggag ccacatcacc cagaaggatt ggagagaatt
     2401 aaggagctcg agcaagatcg tcgccaaggc atcgccgaag ttgaagatcg cacttgtgac
     2461 gcggccccca aattcctcaa cgatcttccg gatatccagc tcaatgagca cgagaatatc
     2521 cacgttgatc ttcgcgcaac gccagtcaat gacccgacga tggtcattga atggtttgtc
     2581 aacggacgcc cattgttgac tggaagtcgt gtcaagaccc tcaacgaatt tggtttcatt
     2641 gctctagaca tcaaaggagc gattgccgaa gactctggaa cctactcggt cagagccagc
     2701 aatcttctcg gggaggccat tcgccaatgc gtgattactg ttacgccagc cggccaaatt
     2761 ctgtccgaca ctcaacatca agaatctctc ggaaaaatca actatctcga gaatcttaat
     2821 aagtacggaa gagtggagat tgaagataag gggccacaag agccaccgac attcgttgtt
     2881 ccacttcaag ccgatttggg agatgttgaa gaaggcgagc caatccattt ggagtgccaa
     2941 gtaaacccga tcaatgacaa ctccttgaaa atcatatggc tccgtgatgg acagtcgctt
     3001 ccacatggtc accgtttccg tacattctat gatttcggat ttgtgtcact ggatattctc
     3061 ggcttctacg ctcaagacgc cggaacatac acttgtcgcg cagaaaattc gctggggcag
     3121 gctgaaactg ttgccactat tagatgtgca ccaaaagatg ccatcctcgg agcagttcaa
     3181 cacccaagaa gctatgctag aattcaggag attgaggcgc cgaaaccagc gccacaagag
     3241 gttccagatc ttccacatca gccaccagca ttcgtgaagc agttgggacc agctattcag
     3301 tgtatggagg gagacaatgt gtacctagag gctcaagtga cacccactga tgataattcg
     3361 ctaacttacg aatggctcgt caatggtcag ccactcatga aggcccatcg ttttgtattg
     3421 tctcaagact ttgggtacat tgcgctgaac attctctact gttatccgga agataatggt
     3481 acgtacacac tagttgtgcg aaaccgagca ggagaagctc aatcgacggt cgacatcaac
     3541 tgtgggcata ctggaggaaa tttcaccgac tcattccatc caaactctct ccatcgtatt
     3601 gccgagctcg agactcctat tcaacgagcc gagccacttc cagacaagga aaaggaagta
     3661 ccaacgattg ccaagccact tccagcgact atcgactcgg tccacgagtc acagactctt
     3721 catttggagg ctcaagtcac cccgattgac gataatactc tgagatacga atggttgttc
     3781 aacgggaacc cactgaaggc atccagcaga tatcgtgttc tcaatgactt tggatttgtg
     3841 tccctcgaca ttgactacat cattgccgag gacagtggaa agtacacctt ggtcgtttac
     3901 aactctgccg gacgtgctga gacctcttgc gaattccaag tcgatcgcct gaagtcgatt
     3961 ctctccgaca ccgctcatcc ggaatctctt cgtcgtattc gtgagatgga gcaacttcaa
     4021 ccagctaagc catcggatga tgatgcagct gctcagccac cggtgttcac tcaacaactc
     4081 accggaccaa ctgagccact caaggaagga caatcggttc atatggactg cgttgttcag
     4141 ccgatcaatg atcctagtct gagaatcgag tggttccacg acggaagacc attgatgttc
     4201 ggatcgcgta tccgtactat tcacgacttt ggatatgtcg gtcttgagtt ccttcacatc
     4261 cacccagagg atactggaac ttacacttgc aaggctacca atcttattgg tgaagctacc
     4321 accgacatct tcttggagtg caagccacgt cgcaacatct atcttgacac tcaccacgag
     4381 tcttcgtggc agaagattca agaaatcgag aaccgtgtgg atgagcgtga accaacgccg
     4441 gaacttacat tccagccacc aacgttcact gagaacctgg ctgacaagga agatgctcaa
     4501 gaaggacaat cgattcgtct cgagtgccgc ttgattccag ttaacgatcc aacaatgaga
     4561 gtcacttgga caagaaatgg tcagccactt ccagaagctt caagattcat gccagcaaga
     4621 aactttgatt atgtcaactt ggacattctt gcgttgtacg gagaagactc aggtgtctac
     4681 acttgcaaag ctgtttcagc attcggagaa gctgccacct catgcacagt caagtgtgcc
     4741 gcaggaaaat cacttcttct tgataccatg catgatgctt cctggaagcg tgttcaagaa
     4801 attgaaaacc gtgagaagct agaggcagtg gatgctgagc cagaaaagac tgcaccaaag
     4861 ttcgtcactc agctcaattc ctcccttgga gagcttcaag aaggagttcc aattcatttg
     4921 gaagcacaag tggagccaac aaacgacaat cagctcacag tacaatggtt ccacaatgga
     4981 caaccacttg ccaatggaca tcgtttccgt actcgtcacg atttcggata tgtcgctctt
     5041 gacatcttgt acgcatttgc gcaggatact ggagaatggg catgtgttgc cagaaactcc
     5101 ctcggagagg cacagaccat cgcaaacttc acagttttgc cacgtggaac tatctacacc
     5161 gattctcaac acccagaaag ttggcagaag attcaagtac ttgaagcacc acgagctgca
     5221 gcaccggaga agcctgatgc tgagcatgat gctccacaat ttattgagcc actcgacagt
     5281 atcgatagaa tggaattcca atcagctcac ttccagacca aggtcactcc acaaacggat
     5341 ccaaacctta gaatccaatg gttcaaggat ggtcagccat tgatgaactc taaccgattc
     5401 aagttgacta ccgacttcgg atacatctca ctggacattg ctcacactgt tccagaagac
     5461 agcggtgtct attcagtcaa ggcaagcaat gccaagggag acgctgaagt tcaagctcag
     5521 ctcactgtaa ctggaaacgc tgttatcctt ggagacactc aacacgaaca atcatggcag
     5581 aagattcagc tcatcgaagc tccaagagcc cctggagagg aggagcctga tgtcaagcac
     5641 ggaccaccaa agtttgtcac ccaattgcat agccttgatg gagtggttga aggacagcca
     5701 tctcactttg aagcccagtt cattccgttc tcggatccaa aaacatctgt tcaatggtat
     5761 ctcaacggaa atccactctc tgcgtcttct cgcagaatcc tacgcaacga ttttggactt
     5821 gtctccttgg atcttcaata cacacttgga gaagatgctg gagaatatag cgtcgttgtc
     5881 aagaactctg aaggtgaaga tagaacatct ggacagctgt cgtgtaccac tagggccgcg
     5941 attcttggag acactcaaca cgagcaatcg tggcagagaa ttcaagagat cgaagctcca
     6001 agagctccag gcgccgagcc ggaaggaccg gtctatgaga agccatcctt cgttcaaccg
     6061 cttcagtccg tcggagatct gcctgaagga tctgttgctc ttctcgaggc tcgtcttgtc
     6121 ccagtcaatg atccaaatct tcgagttcaa tggttctata acgatcagcc attgatggag
     6181 tctaactgga tctcaaccag caacgacttt ggatgtgtct cgttgagaat tgctccagtg
     6241 tacgccagac ataccggagt atactcttgc aaggcctgga acgacagtgg aaacgctgtc
     6301 acatctgcga atgttggagt tcaaggatca gaaggccttc ttctggatac ttctcatcca
     6361 gcgtctcttc agaagattca agagctcgag gctatcgaca agtacgcaag acttgatgca
     6421 cctgaaagag aatacgagaa acctcaatgg gttcaaggat tcgaaaacta cgaaaatgtt
     6481 ggagaaggac aaactgtcac tcttcatgga ctcgtcgaac catctggaga tccacatctt
     6541 cgtctcgaat ggctccttaa cggaactcca cttcgaaatg caaaccgttt ccgtcaagag
     6601 tatgagttcg gaaacgcaat cctcaccatc gttcacgtcc tcccacacga ctctggtgtt
     6661 tacacctgcc gtgcctggaa tactcaagga gaagcttcaa catctgcgac cgtgactact
     6721 gctggctacg agaagatttt gtacgactcg cagcacccag tttcatggga gcgtattcaa
     6781 gagcttgagg ctccgaagat cgtcgaggaa attgaggaaa ttgttcaaaa ggagaaacca
     6841 aacttcctta ctcaactgga gtcggctgaa aatgttccag aaggagtccc acttcacctg
     6901 gaatctacat tccagccagc tagagaccca gaacttaagg ttgtttggca gaagaacggc
     6961 cagccactcg gagcttcaca gttggtgcag actaaacatg aacttggatg ggctacactg
     7021 gacatttcct cagcaaatga agatcacaat ggagtgtaca ctcttacaat taccaacagc
     7081 gaaggagagg ctgtgtcgac cgcttcaatc cgggtagccg gaactggacc gattcttgga
     7141 aacactcgtc atgaagaatc atggaaacgc atccagattc tggaagctcc aaaggaagct
     7201 gaaccggaag cgccagctcc agtatatgac catccagcaa tcaccacgca gattgatgat
     7261 aaggagtgca atgaaggaga ccacgttcac tttgaggcac tcatcactcc agtcaacgat
     7321 ccaagacttc aagttcaatg gattcgaaac ggagttccac ttgctcatgg atcaaagtac
     7381 gccattcaac aagactttgg aatctgcact ctcgatgttg cctacactta tccggaagac
     7441 gaaggtgtct atcaacttcg tatctggaat ccagaaggag aagctgtgtc atctgccacg
     7501 ctcaagtgtc atggaaagga tgcaattctc ggagacgtgc aacatcaaga aagctggaag
     7561 cgtattcaag aaatcgaggc gccaaagcaa aagcttgagg aagccgatcc ggagccaaag
     7621 ggtccaccac ggttcatcca acagctcacc agcccgggaa gtctcgtgga aaaccaacca
     7681 gctcactttg aagctactgt cgaaccagtc gatgatccaa ctcttacgat caactggttc
     7741 cttaatggag agccaatgtc tgcgtcgtct cgtgttaaga tgatcaatga ttttggatgg
     7801 gtgatcatgg atattgctca aaccgaacca agagattctg gagaatggaa atgtgttgct
     7861 aagaacgcag ctggagaagc tgtctcaaca gcaacgattg aagttcaagg aaaggaagtt
     7921 atccttcaag actctctcca gccacaatca cttgatcgta ttcgccagat tgaagctgga
     7981 aaacctgctc cagaagagcg cccagatcaa cagtttgagg ctccagctat cgtcaacgct
     8041 cttcaagtcc agggagcgtt ggaagaggga ggaagtgctc atcttcaaac ccaattcact
     8101 ccagtggctg atccctcgat caaggtggaa tggctcaagg atggtcaacc gatcttccac
     8161 tcaaatagat acaagatggt tcacgacttc ggattcgctg ttttggacat tttgcatcta
     8221 ctgaaacacg atgctggaga gtatactttc cgagtttcga acaactcggg agaagcatct
     8281 acttctacaa gtttcgaagt ttccgagagc tctggtctta ttcttcagcc acagaatgaa
     8341 cagaaggcga aggccgtcga aattctcgag gataacttaa gaagacgccc tgaagaaatc
     8401 gagcaagagc ttaaggaggc tacaccagtc ttcattgagc cactctcggc tccagttgaa
     8461 actgaggagg gcggacgtgc tcatttcacg gctcgttacg agccagtcaa tgacaatcag
     8521 cttcaggttc aatggtacca tgatggtcgc ccattgaaga atggaagtcg tatcaagact
     8581 atcaacagtt ttgggtacgt cgttcttgag atcagcccaa catatccaga agacaacgga
     8641 gagtacattt gtcgtgctgt gaaccgtgtt ggagaggcag tcacctcgac aaagcttacc
     8701 tgcacaccta aagaaggaat catcagtgcc actcaacttc cagaacgcat ggcaaacgcg
     8761 ggaagacgaa ttgccgagat tgaagcacca agaccagctc gtgaagatgc tccagacgct
     8821 gatcatggac caccaaagtt cacgtcggca cttgcaggac caccagagtt gcaagaagga
     8881 caacaggctc acttggagtg ccaagtcact ccagttgctg atccaagact ggtgatcgag
     8941 tggttccaca atgggcaacc agtgaatcac actaacagaa tgaaggctat ccatgatttc
     9001 ggtttcgtgg ttcttcaact gacaccagcc gaaccacaag actctggaac ctggacttgc
     9061 cgtgccacca atcaacatgg atctgatgaa gtatccacag agctcaaggt cgtcggcggt
     9121 ggcggtgtct catacgaatg gcagagcact gcagagcgca aggagcgcat cacagagctc
     9181 gaggactgga ttcatagacc gaaggaggat ctcaatcttc cagccgtcga ctatccagca
     9241 ccatccttct ctcaaggtct caccgatctt ggacagctca acgaggccga tgctacagcg
     9301 tttgtgtgtg ttttggagcc aattggagat ccaactctcc gagttcaatg ggagcataat
     9361 ggacatccga tcccatactc caatcgtata tcttgcacaa atgaatttgg agttgccact
     9421 cttctcatca agcatctcat tgccgccgat gctggagagt acaagtgtgt tgccactaac
     9481 gtcaaggggt ccgctacatc tgtcggaaag attgccgtcg agtcatccac tcaaattgat
     9541 gctccacaag tcgttcaaca actcgttgac agtgttgaaa acattttgga aggagattca
     9601 atccacctcg aatgtcgtgt cactccaatc aacgacccac gtcttcatgt ggaatggctc
     9661 agaaatggag caccacttcc agaagccagt agattcaagc caacgttcga gtttggcttt
     9721 gtcagcctgg atattcttta tgcttaccca gaagacaatg gagattacga acttgtcgtc
     9781 cgtaacgaca agggtgaggc tcgttccaag acgaagatca cagttcttcc aagaccatct
     9841 ttggactaca cttctcaaac tcatggaaac caacaagatt ccctggaatc tcacttcaaa
     9901 caacattctc aagctaaact tcagctcacc gccaatgaca tctacaacga gagtgacaag
     9961 cgcgctccag agtttcgtac tcaacttcag aacatcggag tcttggaagg agagttctgc
    10021 cgcttcgaga cccaagtcgc accaatcaac gatccatacc tcaaagttga atggttcaag
    10081 gacaagaagc cagttcttct tggacatcgt ttccgatcaa ctctcgactt tggattcgct
    10141 tgcctcgatc ttctgtatgc tcttccagat gacactggag aatatcactg cgtcgccaca
    10201 aaccggcatg gtcaaactat gatcagcgct aagttggcgt gccagggagc ttctcatgtg
    10261 atcaccgata gccagatgcc acagggcttg agagtcagca atgtgaagaa ggacaacaag
    10321 aacatctact ggagtgaaca aggaggagct gtgcagccaa aacaaaagca ggcaccacag
    10381 ttcactattc cactccgaaa ccttcaagtc acagagaatc agccagctcg ctttgaatgc
    10441 gctgtaactg gatatccaag accaaaggtc acctggttca tcaatggaaa ccaatgtctc
    10501 catggacacc gcttcaagct caacttcgac ggtcttcact atcttaccgt cagcaagtcc
    10561 agaatctcag acgctggaga agttgttgcg attgctagaa acaccgaagg agaaacaatt
    10621 tctactgcta ccctcgacat cttccaaaac gatgacttca gacagaccaa gttgagaccg
    10681 gctaacttca agacatccga tgagttgaga gaaagagagt tgcagtggca acgtgatact
    10741 ttgggatctc ttggcccagc gtttgaggct gctccaaaac cagatgctca aaaacttatg
    10801 cacgtggaaa gagcccaaag cccgatcgaa ccaatggagt cccaggagct tattcagaag
    10861 ttcacacgcc cacgcgacga caacttctac aataagcttt cttacgtcga gcttcagaag
    10921 ccacaattca agggaatgga gctcgaggaa gtcaatttga aagctggtaa agttgagaag
    10981 tatcaaccac cagttgaaga aatggaacga gtcaatctca aggccatccc agaaaaagat
    11041 caacaagagg tcggatggga aagacccgac tgggccggac aggatggtac gtcgaagttg
    11101 ccaggagccg atgaaggtcg cttcaagaaa cttccaactc cagcgccaga gctcgacgtt
    11161 ccagccagag atcaagttaa gcttaagacc gcaaagccaa cacgtggaaa ggacttggag
    11221 gccggtgaga aggtgaagct gaagactgaa aaggcaaaga tcaaggagat tcaacaaaag
    11281 ccagaacagc caaaggaaga gccaattgtt cacaaggatg cggttcagct taagactcaa
    11341 caacttccaa agactggcat caagggagat cacttcaccg ttgacagaga aaaagatctg
    11401 aaggagactc cagcagtggt aaagcctgtt attgaggaga caagaatcag caacaagcca
    11461 caaccaacaa agatcgggca atctaagcaa gctccaccga caatctccca gcagttgaaa
    11521 ccactgcaag gagaacttgg aaaagccgcc aagtttgtta tcgaatttgc cggtgccgct
    11581 ccagtcaagg tcacttggct taaggacgga aaggagatta agagcacttt cagaactttg
    11641 atcactacca ctccaacaaa ctccagcctt cacatcggtc gccttgaaaa ctcccacgcc
    11701 ggagaataca cagtacgact ggagaacgcc gctggaaccg ttgaatctct agccaatctt
    11761 actgtcgctc caccaaccac acaaggaaag gctccagact tctcggcgcg tctcaacgat
    11821 ctcagaatcc aacagaatgg tccagctgag ttctcctgcc aaatcggagg agaaccaaag
    11881 ccaacaatcc aatggttcaa ggatggacaa cctcttccaa atgacgatcg attccaagtt
    11941 gtcgaggaag gaggcgccta caagctcaag ttctcgaaca tcatctctac cgatgccgga
    12001 atctacgaga ttgttgctaa gaacggagtc ggagaggctc gctgcaaggc tcgcctcaac
    12061 gtaaacctcc agaagaccgg aaagggtgcc gaagaaggac cacggtacga agcgccaaga
    12121 ttcacatccc agattcaacc catcgttgtc gatgaaggaa agggtgctca gtttagtgca
    12181 cagttctccg gattccctga tccgacgatc cgatggtata gaaacaatga gcccgtgaaa
    12241 cacgccgacg gatatgagat ttcccaatcg aagggagaag ccatcctgag gatatctgca
    12301 gcgagaaatg aagatgttgc agagtacaag gttgaagcta gcaatccagc cggaaaggct
    12361 tcatcggttg ccaacttggt tttgactcca cgatccggaa gaatcgccaa gtcgacgatt
    12421 tcccgtggtg gatctgcatc atatcaatcg tccgacaagg ccgccgccga ctctccacat
    12481 tttatcgcaa aactttccga catctctgcc cgacaaggac acactgtcaa attcagcgcc
    12541 gaggtggacg gaaatccgga gccaactgtt cagtggcaat tcaagggaaa accaatttct
    12601 gcgtctaaca acgtaaagat ctcacgtgac ggcaagcgtg ccattctcga gctggctcga
    12661 gtcacgcccg acagcgccgg agagtaccag atcgtcatca gaaacgacaa gggagctgcc
    12721 acgtcacaag ccaagctcac actcagtcgc tag
//