Dbfetch

LOCUS       NM_068507               1848 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Prion-like-(Q/N-rich)-domain-bearing protein
            (pqn-22), partial mRNA.
ACCESSION   NM_068507
VERSION     NM_068507.4
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1848)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1848)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1848)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1848)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            On Apr 20, 2015 this sequence version replaced NM_068507.3.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1848
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>1848
                     /gene="pqn-22"
                     /locus_tag="CELE_C46G7.4"
                     /db_xref="GeneID:177369"
                     /db_xref="WormBase:WBGene00004112"
     CDS             1..1848
                     /gene="pqn-22"
                     /locus_tag="CELE_C46G7.4"
                     /standard_name="C46G7.4b"
                     /note="Product from WormBase gene class pqn;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Prion-like-(Q/N-rich)-domain-bearing protein"
                     /protein_id="NP_500908.2"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004112"
                     /db_xref="EnsemblGenomes-Tr:C46G7.4b"
                     /db_xref="GeneID:177369"
                     /db_xref="UniProtKB/TrEMBL:Q9TY23"
                     /db_xref="WormBase:WBGene00004112"
                     /translation="MNTQNYTYSTTGYQPSQPSGGQQSYNETRQYSSNATSNYPSQTQ
                     QYQQQQHQYQSDHSNAQRLLNSGYNTNQVDYVLGHKDKYNEGPHYQPPIINSSATAAN
                     NSSSSTHHYNSSSQAIPLGGPNQGHSSSSYTTETRVTGGGTGAPVSNNYSNQNYSSSA
                     YNSQSSQHQTKSIPVQNYQISFPPLSVSTPAFGTSFFENSQKSFQESSEKFHRDLASP
                     LSRTIPVQSAGHFSEVSKYFNSEETNHESRQESRCHSEVAETTETSEKKEENYQVSQP
                     AIPLPSADQVYESSNYNKSYSSQTTTQHQPQPVAANNNYSTSYHTERSSTTTAQQPQT
                     IALPPPQNNSSHTETHSSTGPIMMHSPGGHSMKSTEFSSSRHHKQETTTTTTTTPQPP
                     VFQTTTYPTTKTTSYNYSSSTIPSQPAKPSFNQESYTTHTERNNSSQGFPQQRLQPSG
                     GYSYENYSSSRKEENRREETSRPVSQLSQYSESRNYKRNYEEKTETTTVPSLAPATNV
                     TYKDLSNAQCVDDVFNKKTEMNESLPVGSVFNTHNNTEGGYRDANGHDVSYKRETQTS
                     ADPGRETALLKEEEKRVVETPLEPGVISRHVTTKYYKKKTVTDTTTTTA"
ORIGIN      
        1 atgaacactc aaaactacac ctactcaaca actggatacc agccatccca accatcgggt
       61 ggtcaacaat catacaatga gaccagacaa tactcatcca atgctacttc caattatcca
      121 tcacaaactc aacaatatca gcaacaacaa catcaatatc aatcggatca ttcgaatgct
      181 caacgtctct tgaactctgg ttacaacacg aaccaagtag actatgtact cggtcacaag
      241 gacaagtaca acgagggacc acattatcaa ccaccaatta ttaattcatc agctactgct
      301 gcaaacaatt cgtcatcctc aacccatcac tacaactctt catctcaagc aatcccactt
      361 ggaggaccaa atcaaggaca ctcttcgtcc tcttacacta ctgagacaag agttactgga
      421 ggaggaactg gagccccagt aagcaacaac tacagtaacc agaactattc ttcatctgct
      481 tataactccc agtcttctca acatcagaca aaatcgattc ctgttcagaa ttatcagata
      541 tccttcccgc cactttctgt ttctactcca gcttttggca cttcattttt cgagaattct
      601 caaaaatctt tccaagaatc cagtgaaaag ttccatcgtg atttggcttc tccactttct
      661 agaactattc cagttcaatc tgccgggcat ttttctgaag tttctaaata tttcaattcg
      721 gaagagacaa atcatgaatc ccgtcaagag tctcggtgtc atagtgaagt tgctgaaact
      781 actgaaactt cagagaaaaa ggaggagaac tatcaagttt ctcaaccagc tattccattg
      841 ccatcagctg atcaggttta tgagagctcc aactacaaca agagctactc aagccaaact
      901 accactcaac accaaccaca gccagttgct gctaacaaca actactcgac tagctatcat
      961 accgagagat cttctacgac aactgctcaa caaccacaaa caattgctct tccaccacca
     1021 cagaacaatt caagccatac cgagactcac agctccactg ggccaatcat gatgcattct
     1081 ccaggaggtc attcaatgaa gagcactgaa ttctcatcaa gccgccatca caaacaggag
     1141 actacaacaa ctacaacaac aactcctcag cctccagtat tccaaactac aacctatcca
     1201 acgaccaaaa ctacttcata caattattct tcgagcacca tcccatcgca gccagccaaa
     1261 ccatcgttca accaggaaag ctatacaact cacacagaga gaaacaattc ttcgcaagga
     1321 ttcccacaac aaagacttca accatccggt ggatattctt acgaaaacta ttccagcagc
     1381 agaaaggaag agaaccgccg tgaagagacc tcccgtccag tttctcaact ttctcagtat
     1441 tcggaatccc gtaactataa gagaaattac gaggagaaga ctgaaactac aacagttcca
     1501 tctcttgcac cagcaaccaa tgtcacctat aaagacttat caaatgctca atgtgtagat
     1561 gatgttttca ataagaagac tgaaatgaat gagtctcttc cagttggatc cgttttcaat
     1621 actcataata atactgaggg aggctaccgt gatgcaaatg gacatgatgt atcttacaaa
     1681 agagaaactc aaacatcagc tgatccagga agagagacag ctcttctaaa agaggaagag
     1741 aaacgagttg ttgaaactcc attggagcca ggagtcatct ctcgtcacgt cactaccaag
     1801 tattacaaga agaaaactgt cactgataca accaccacta ctgcctaa
//