Dbfetch

LOCUS       NM_068505               2778 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Prion-like-(Q/N-rich)-domain-bearing protein
            (pqn-22), partial mRNA.
ACCESSION   NM_068505
VERSION     NM_068505.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 2778)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 2778)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2778)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 2778)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            On Aug 9, 2005 this sequence version replaced NM_068505.1.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..2778
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>2778
                     /gene="pqn-22"
                     /locus_tag="CELE_C46G7.4"
                     /db_xref="GeneID:177369"
                     /db_xref="WormBase:WBGene00004112"
     CDS             1..2778
                     /gene="pqn-22"
                     /locus_tag="CELE_C46G7.4"
                     /standard_name="C46G7.4c"
                     /note="Product from WormBase gene class pqn;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Prion-like-(Q/N-rich)-domain-bearing protein"
                     /protein_id="NP_500906.2"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004112"
                     /db_xref="EnsemblGenomes-Tr:C46G7.4c"
                     /db_xref="EnsemblGenomes-Tr:C46G7.4n"
                     /db_xref="GeneID:177369"
                     /db_xref="InterPro:IPR006643"
                     /db_xref="UniProtKB/TrEMBL:H2KZA4"
                     /db_xref="WormBase:WBGene00004112"
                     /translation="MPQTVHLQYNSPMGLYSKEAAVEQFQQQIGETPNDLPAQEKHFD
                     PSKSATLKYLKEGERENFGENFFEKVAQAEAPRVPYQSEPNWARTAREKSERARSKTP
                     ADPHTAYRPASSPAPANHPVHAENAREHAEKSKVFTHNINEPFGRSYWEASNTVPRYG
                     RSHSVGRELYNRGYELGGMDYTGGIHVDHGTDYQYYEEPARKPQTPKLPPGYELGGTD
                     FYKGHVPGDANYRGHGPDPPRLRPKYTADSHDPCNVAIAPNLEGVDANLLVGDTLSNQ
                     KIRHEVRHIDQTKFGTSFGPTKGFSYDHHTVPRYVEPPKPVVYSLSANKSLARSASVP
                     RSSAPPEQRDVWNIQQSEVDKETYITEPNWRRNVDQRRLAWERRAFETEQHLSRPYSE
                     KVAPGVPPAWHAEAQHKHQQWQQQADNMNTQNYTYSTTGYQPSQPSGGQQSYNETRQY
                     SSNATSNYPSQTQQYQQQQHQYQSDHSNAQRLLNSGYNTNQVDYVLGHKDKYNEGPHY
                     QPPIINSSATAANNSSSSTHHYNSSSQAIPLGGPNQGHSSSSYTTETRVTGGGTGAPV
                     SNNYSNQNYSSSAYNSQSSQHQTKSIPVQNYQSSNYNKSYSSQTTTQHQPQPVAANNN
                     YSTSYHTERSSTTTAQQPQTIALPPPQNNSSHTETHSSTGPIMMHSPGGHSMKSTEFS
                     SSRHHKQETTTTTTTTPQPPVFQTTTYPTTKTTSYNYSSSTIPSQPAKPSFNQESYTT
                     HTERNNSSQGFPQQRLQPSGGYSYENYSSSRKEENRREETSRPVSQLSQYSESRNYKR
                     NYEEKTETTTVPSLAPATNVTYKDLSNAQCVDDVFNKKTEMNESLPVGSVFNTHNNTE
                     GGYRDANGHDVSYKRETQTSADPGRETALLKEEEKRVVETPLEPGVISRHVTTKYYKK
                     KTVTDTTTTTA"
ORIGIN      
        1 atgccacaaa ctgtacatct tcagtacaac tcgccaatgg gattgtattc caaggaggcc
       61 gcagtcgaac agttccaaca acaaattgga gaaaccccaa atgacttgcc tgctcaggaa
      121 aaacactttg atccctccaa aagtgcaact ttgaagtact tgaaggaagg cgaacgagaa
      181 aactttggcg aaaacttttt cgaaaaagtg gctcaagccg aggctccacg agtcccatat
      241 caatcggagc caaattgggc acgcactgca agagagaaaa gcgaacgagc acgaagcaag
      301 actccagctg atccacacac agcttatcgt ccagcaagtt cacctgcacc agccaatcat
      361 ccagtacatg ctgaaaatgc tcgtgagcac gctgaaaaaa gcaaagtatt cacacataat
      421 ataaatgaac catttggaag atcttattgg gaagcaagta atactgttcc aagatatggt
      481 agaagccatt ctgttggacg tgaactttat aatagaggct atgaattagg aggaatggat
      541 tatactggtg gaatccacgt ggatcatgga actgattatc aatattatga agaaccggct
      601 agaaaaccac agacaccaaa actaccacct ggctatgaat tgggaggtac tgatttctat
      661 aaaggacacg ttcctggtga tgcaaactat cgtggacacg gaccagatcc accaagactt
      721 cgtccgaagt atactgcgga ttctcatgat ccatgtaatg ttgctatagc accgaatttg
      781 gaaggggttg acgcaaattt actcgtcggt gataccctct caaatcaaaa gatccgtcat
      841 gaagtccgtc acattgacca aacgaaattc ggaacatcat ttggaccaac taaaggattc
      901 agttatgatc atcacactgt tccaagatat gttgaaccac caaagccagt tgtctactct
      961 ttgtctgcca ataaatcatt ggctcgttct gcatcagttc cacgttcatc tgctccacct
     1021 gagcaacgag atgtttggaa tattcaacaa tcggaagttg ataaggagac ctacatcact
     1081 gagccaaatt ggcgccgaaa tgtggatcaa cgtcgtcttg cgtgggaacg acgtgctttt
     1141 gaaaccgagc aacatttgag ccgcccgtat tctgaaaagg tggcgcctgg cgtgcctccg
     1201 gcctggcatg cagaggcaca acacaagcat cagcagtggc agcagcaggc ggataatatg
     1261 aacactcaaa actacaccta ctcaacaact ggataccagc catcccaacc atcgggtggt
     1321 caacaatcat acaatgagac cagacaatac tcatccaatg ctacttccaa ttatccatca
     1381 caaactcaac aatatcagca acaacaacat caatatcaat cggatcattc gaatgctcaa
     1441 cgtctcttga actctggtta caacacgaac caagtagact atgtactcgg tcacaaggac
     1501 aagtacaacg agggaccaca ttatcaacca ccaattatta attcatcagc tactgctgca
     1561 aacaattcgt catcctcaac ccatcactac aactcttcat ctcaagcaat cccacttgga
     1621 ggaccaaatc aaggacactc ttcgtcctct tacactactg agacaagagt tactggagga
     1681 ggaactggag ccccagtaag caacaactac agtaaccaga actattcttc atctgcttat
     1741 aactcccagt cttctcaaca tcagacaaaa tcgattcctg ttcagaatta tcagagctcc
     1801 aactacaaca agagctactc aagccaaact accactcaac accaaccaca gccagttgct
     1861 gctaacaaca actactcgac tagctatcat accgagagat cttctacgac aactgctcaa
     1921 caaccacaaa caattgctct tccaccacca cagaacaatt caagccatac cgagactcac
     1981 agctccactg ggccaatcat gatgcattct ccaggaggtc attcaatgaa gagcactgaa
     2041 ttctcatcaa gccgccatca caaacaggag actacaacaa ctacaacaac aactcctcag
     2101 cctccagtat tccaaactac aacctatcca acgaccaaaa ctacttcata caattattct
     2161 tcgagcacca tcccatcgca gccagccaaa ccatcgttca accaggaaag ctatacaact
     2221 cacacagaga gaaacaattc ttcgcaagga ttcccacaac aaagacttca accatccggt
     2281 ggatattctt acgaaaacta ttccagcagc agaaaggaag agaaccgccg tgaagagacc
     2341 tcccgtccag tttctcaact ttctcagtat tcggaatccc gtaactataa gagaaattac
     2401 gaggagaaga ctgaaactac aacagttcca tctcttgcac cagcaaccaa tgtcacctat
     2461 aaagacttat caaatgctca atgtgtagat gatgttttca ataagaagac tgaaatgaat
     2521 gagtctcttc cagttggatc cgttttcaat actcataata atactgaggg aggctaccgt
     2581 gatgcaaatg gacatgatgt atcttacaaa agagaaactc aaacatcagc tgatccagga
     2641 agagagacag ctcttctaaa agaggaagag aaacgagttg ttgaaactcc attggagcca
     2701 ggagtcatct ctcgtcacgt cactaccaag tattacaaga agaaaactgt cactgataca
     2761 accaccacta ctgcctaa
//