Dbfetch

LOCUS       NM_068422               2760 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Netrin receptor unc-5 (unc-5), partial mRNA.
ACCESSION   NM_068422
VERSION     NM_068422.5
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 2760)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 2760)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2760)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 2760)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            On Jun 26, 2012 this sequence version replaced NM_068422.4.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..2760
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>2760
                     /gene="unc-5"
                     /locus_tag="CELE_B0273.4"
                     /db_xref="GeneID:177334"
                     /db_xref="WormBase:WBGene00006745"
     CDS             1..2760
                     /gene="unc-5"
                     /locus_tag="CELE_B0273.4"
                     /standard_name="B0273.4a"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Netrin receptor unc-5"
                     /protein_id="NP_500823.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006745"
                     /db_xref="GeneID:177334"
                     /db_xref="WormBase:WBGene00006745"
                     /translation="MDEITITTQPKSGYVIRNKPLRLQCRANHATKIRYKCSSKWIDD
                     SRIEKLIGTDSTSGVGYIDASVDISRIDVDTSGHVDAFQCQCYASGDDDQDVVASDVA
                     TVHLAYMRKHFLKSPVAQRVQEGTTLQLPCQAPESDPKAELTWYKDGVVVQPDANVIR
                     ASDGSLIMSAARLSDSGNYTCEATNVANSRKTDPVEVQIYVDGGWSEWSPWIGTCHVD
                     CPLLRQHAHRIRDPHDVLPHQRRTRTCNNPAPLNDGEYCKGEEEMTRSCKVPCKLDGG
                     WSSWSDWSACSSSCHRYRTRACTVPPPMNGGQPCFGDDLMTQECPAQLCTADSSRIVI
                     SDTAVYGSVASIFIVASFILAILAMFCCKRGNSKKSKPLKPQKMNSEKAGGIYYSEPP
                     GVRRLLLEHQHGTLLGEKISSCSQYFEPPPLPHSTTLRSGKSAFSGYSSTRNAGSRAA
                     LIQECSSSSSGSGGKRTMLRTSSSNCSDDDNYATLYDYMEDKSVLGLDTSQNIVAAQI
                     DSNGARLSLSKSGARLIVPELAVEGEKMLYLAVSDTLTDQPHLKPIESALSPVIVIGQ
                     CDVSMSAHDNILRRPVVVSFRHCASTFPRDNWQFTLYADEGSGWQKAVTIGEENLNTN
                     MFVQFEQPGKKNDGFGWCHVMTYSLARLMLAGHPRRNSLSAAKRVHLAVFGPTEMSAY
                     RRPFELRVYCVPETGAAMESVWKQEDGSRLLCESNDFILNEKGNLCICIEDVIPGFSC
                     DGPEVVEISETQHRFVAQNGLHCSLKFRPKEINGSQFSTRVIVYQKASSTEPMVMEVS
                     NEPELYDATSEEREKGSVCVEFRLPFGVKDELARLLDMPNESHSDWRGLAKKLHYDRY
                     LQFFASFPDCSPTSLLLDLWEASSSGSARAVPDLLQTLRVMGRPDAVMVLERFLSAFP
                     QIVSP"
ORIGIN      
        1 atggacgaaa tcacaatcac aacacaacca aaatccggtt atgtcattcg aaataagcca
       61 ttgcgtcttc aatgccgagc caatcacgca acaaagattc gttacaaatg tagctcaaaa
      121 tggatcgacg attctcgaat cgaaaagctt atcggaaccg actcgacgtc tggagttgga
      181 tacattgacg cttcagttga tatttctcga atcgacgtag acacatctgg acacgttgac
      241 gcttttcagt gtcagtgtta cgcttctgga gacgacgatc aagacgttgt ggcttctgac
      301 gtggcgacag ttcatttggc ttatatgcgg aagcactttc tcaaatcacc cgttgctcaa
      361 cgggttcaag aaggcacaac cctccaactt ccctgtcaag caccggaatc agatccgaaa
      421 gcagagctca cctggtacaa agatggagtc gttgtacagc ctgatgcaaa tgttatccga
      481 gcatctgatg gaagtctaat tatgtcagcc gccagattat cagacagtgg aaattataca
      541 tgtgaagcca caaatgtggc gaattcgagg aaaactgacc cagtggaagt acagatttat
      601 gttgacggtg gttggtccga atggtccccg tggatcggaa cgtgtcacgt cgactgtccc
      661 cttctccgtc aacacgccca tcgaatccgt gatccgcatg acgttctgcc ccatcagaga
      721 agaacacgaa cttgtaataa tccagctcca ttgaacgacg gagagtactg taagggagaa
      781 gaagaaatga cgagaagctg taaagtacca tgtaaacttg atggaggatg gagttcatgg
      841 agtgattgga gtgcttgctc ttcgagttgt catcggtata ggacgagagc atgtaccgtt
      901 ccacctccga tgaatggagg acagccatgt tttggagatg atctgatgac acaagagtgt
      961 ccggcacagc tttgcactgc ggactcctct cggatagtaa tcagtgatac tgctgtttat
     1021 ggatcagttg catctatttt cattgttgcc tcatttattc ttgcaattct tgcaatgttc
     1081 tgctgtaaac gtggcaattc aaaaaagtcg aaaccattga aaccgcagaa aatgaattcg
     1141 gaaaaagcag gaggaatcta ctattctgag cctccaggtg ttcgaagatt acttttggag
     1201 catcaacatg gaacattgct cggagagaaa atatcatcgt gttctcaata ttttgagcct
     1261 cctcctctac cacattcaac aactcttcga tctggaaaaa gtgcattcag tggatattct
     1321 tcaacaagaa acgctggctc acgagctgct ttaattcaag aatgtagttc gagtagttca
     1381 ggatctggtg gaaaacggac aatgcttaga acttcaagct caaattgctc ggatgacgat
     1441 aattatgcta cgttatatga ttatatggaa gacaagagtg ttcttggatt agacacttca
     1501 caaaatattg ttgctgcgca gattgatagc aatggagcac gattgtcttt atcaaaaagt
     1561 ggagcaagat taattgtacc tgaattggca gtggaaggag agaaaatgct ttatctggct
     1621 gtttcggaca ccttaacaga tcaacctcac ctcaaaccaa tcgaatccgc tctctcccca
     1681 gtcatcgtca tcggacaatg tgatgtttca atgtcagctc atgataatat tctccgtcgt
     1741 cctgttgttg tatccttccg tcattgtgct tcaacttttc cacgtgacaa ttggcaattc
     1801 acattgtatg ctgatgaagg atccggatgg cagaaggctg taacaattgg agaagagaac
     1861 ttgaatacca acatgtttgt acaattcgag caacctggga agaagaatga tggatttgga
     1921 tggtgccacg ttatgacata ttccttagcg aggttaatgc tagctggtca tccgaggaga
     1981 aattctttga gtgctgcaaa aagagttcat ttagctgtat ttggtccaac tgaaatgtca
     2041 gcttatcgaa gaccatttga attgagagtt tattgtgttc ctgaaactgg agcagcaatg
     2101 gaaagtgtat ggaaacagga agatggatct cgtctacttt gtgaatcaaa tgattttatt
     2161 ttaaatgaaa aaggaaatct ttgcatttgt attgaagatg ttattcctgg attctcatgc
     2221 gatggccctg aagttgtgga aatctcggaa acacaacaca gatttgttgc tcaaaatggc
     2281 cttcattgct cattgaaatt ccgaccaaag gaaatcaacg gctcacagtt ttcaacgaga
     2341 gtaattgtct atcaaaaggc aagctcaacg gagccaatgg tgatggaagt gagcaatgag
     2401 ccggagctct atgatgcaac aagtgaagaa agagaaaagg gatccgtttg tgtagagttc
     2461 cgattgccat ttggagtgaa ggatgaactg gcaaggcttt tggatatgcc aaatgaatca
     2521 cattctgatt ggagaggatt ggcaaagaaa ttgcattacg atagatattt gcagttcttc
     2581 gcctcattcc ctgattgctc tcccacatca cttctcctgg atctttggga agcttcatct
     2641 tctggatcag ctcgtgcagt tccagatctt cttcaaactc ttcgtgtaat gggacgaccc
     2701 gatgcagtaa tggtcctgga acgatttcta tcagcttttc cacaaattgt gtccccataa
//