Dbfetch

LOCUS       NM_067349                555 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans DR1 (One) transcription factor family
            (dro-1), partial mRNA.
ACCESSION   NM_067349
VERSION     NM_067349.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 555)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 555)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 555)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 555)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..555
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>555
                     /gene="dro-1"
                     /locus_tag="CELE_F53A2.5"
                     /db_xref="GeneID:191629"
                     /db_xref="WormBase:WBGene00001092"
     CDS             1..555
                     /gene="dro-1"
                     /locus_tag="CELE_F53A2.5"
                     /standard_name="F53A2.5"
                     /note="Product from WormBase gene class dro;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="DR1 (One) transcription factor family"
                     /protein_id="NP_499750.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00001092"
                     /db_xref="EnsemblGenomes-Tr:F53A2.5"
                     /db_xref="GeneID:191629"
                     /db_xref="GOA:O45550"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:O45550"
                     /db_xref="WormBase:WBGene00001092"
                     /translation="MQCFNTIFRLFTDMDEDNEIGLPQKGINQIIKEVVPEMRIANES
                     RDMINACCVEFVKHIAREAQRIASQDQRKTIYHEHVQKALQNLGFTPDYLEAADSVLD
                     ACKVEAEKKLRRKNSRLEKCGIPEEKLYEMQQELIQKARQQEIEQQLAHQQAQAAAVA
                     AANAQMFGGPSEGSLAPTDDDYDN"
ORIGIN      
        1 atgcagtgct tcaacacaat tttcagactc ttcacagata tggatgagga caatgaaatc
       61 ggacttccac agaaaggtat caaccaaatt atcaaagaag ttgttcctga aatgcgaatc
      121 gccaacgagt cgagagatat gatcaatgct tgctgcgttg agttcgtgaa gcatattgcg
      181 agagaagcac aacgaattgc gagccaggat cagagaaaaa caatatatca cgaacatgtt
      241 cagaaggcac tgcagaattt aggattcaca ccagattatc tcgaggccgc cgacagtgtt
      301 ctcgatgcct gcaaggttga agccgagaag aagctgcgaa ggaagaactc tcgtcttgaa
      361 aaatgtggta ttccagagga aaaattgtac gaaatgcaac aagaattaat tcagaaggca
      421 cgccaacaag aaattgagca gcagcttgct caccaacaag cacaagccgc ggcggtagca
      481 gccgcaaacg cacaaatgtt tggaggacca tcagagggct ctttggctcc aaccgacgat
      541 gactacgaca actag
//