Dbfetch

LOCUS       NM_065327               1335 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Tubulin beta chain (ben-1), partial mRNA.
ACCESSION   NM_065327
VERSION     NM_065327.3
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1335)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1335)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1335)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1335)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            On Jun 26, 2012 this sequence version replaced NM_065327.2.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1335
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>1335
                     /gene="ben-1"
                     /locus_tag="CELE_C54C6.2"
                     /db_xref="GeneID:175461"
                     /db_xref="WormBase:WBGene00000248"
     CDS             1..1335
                     /gene="ben-1"
                     /locus_tag="CELE_C54C6.2"
                     /standard_name="C54C6.2"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Tubulin beta chain"
                     /protein_id="NP_497728.2"
                     /db_xref="EnsemblGenomes-Gn:WBGene00000248"
                     /db_xref="EnsemblGenomes-Tr:C54C6.2"
                     /db_xref="GeneID:175461"
                     /db_xref="GOA:Q18817"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="InterPro:IPR036525"
                     /db_xref="InterPro:IPR037103"
                     /db_xref="UniProtKB/TrEMBL:Q18817"
                     /db_xref="WormBase:WBGene00000248"
                     /translation="MREIVHVQAGQCGNQIGAKFWEVISDEHGIQPDGTYKGESDLQL
                     ERINVYYNEANGGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWA
                     KGHYTEGAELVDNVLDVVRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYP
                     DRIMSSFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLS
                     NPTYGDLNHLVSVTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAK
                     GAQAYRALTVAELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMREVDDQMMNVQ
                     NKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATAEEDGELDGTDGDAE"
ORIGIN      
        1 atgagagaaa ttgttcacgt tcaagccgga caatgtggta atcaaatcgg agccaagttc
       61 tgggaagtga tatccgatga gcatgggatc cagcctgatg gaacttataa gggagaaagt
      121 gatttgcagt tggaaagaat caatgtctac tataatgagg ctaatggcgg caaatatgtc
      181 ccacgcgctg ttctcgtcga tcttgagcca ggaaccatgg attctgtccg ctctggacca
      241 ttcggccagc tgttccgtcc agataacttt gtgttcggac aatccggagc cggaaacaac
      301 tgggccaagg gtcactacac cgaaggagcc gaacttgtcg ataatgtgct cgacgtagtt
      361 cgaaaagagg ctgaaggatg tgattgtctt caaggattcc agttgactca ttcacttgga
      421 ggaggaactg gatctggaat gggaactctt ctcatttcga aaatccgtga agagtatcca
      481 gatagaatta tgagttcttt ctcggttgtt ccgtcgccaa aggtctcgga cacagtcgtc
      541 gagccataca acgctactct ttctgtccac cagctcgttg aaaataccga tgagactttc
      601 tgcattgaca acgaggctct ttatgatatc tgcttcagaa ccctcaagct ttcaaatcca
      661 acttatggag atctcaatca tcttgtttcc gttacaatgt ccggagtcac cacgtgcctc
      721 cgcttcccag gacaactcaa tgctgatctc cgcaaacttg cagtcaacat ggttccattc
      781 ccacgtcttc acttctttat gccaggattt gctccattgt cagctaaagg agcacaagcg
      841 taccgtgcac ttacggtcgc cgagcttacc cagcagatgt ttgacgccaa gaatatgatg
      901 gctgcctgtg atccgagaca cggacgttac ctgactgtag ctgcaatgtt ccgtggacgt
      961 atgtcaatga gagaagtcga tgatcaaatg atgaatgtgc agaataagaa ctcttcgtat
     1021 tttgttgaat ggattccgaa taatgtgaag actgcggtct gtgatattcc accacgtggg
     1081 ctcaagatgt cggccacttt tattggaaac tcgacagcta ttcaggagtt gttcaagaga
     1141 atctctgaac aatttacagc aatgttccgc cgcaaggctt tcctccattg gtatactggc
     1201 gaaggaatgg acgagatgga attcactgaa gctgagagta atatgaacga tcttgtctca
     1261 gaataccagc aataccagga agcaactgca gaggaagatg gagaacttga tggaactgat
     1321 ggagatgctg aatag
//