Dbfetch

LOCUS       NM_064789               1707 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans GEX Interacting protein (gei-4), partial
            mRNA.
ACCESSION   NM_064789
VERSION     NM_064789.3
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1707)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1707)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1707)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1707)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            On Jun 26, 2012 this sequence version replaced NM_064789.2.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1707
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>1707
                     /gene="gei-4"
                     /locus_tag="CELE_W07B3.2"
                     /db_xref="GeneID:175195"
                     /db_xref="WormBase:WBGene00001561"
     CDS             1..1707
                     /gene="gei-4"
                     /locus_tag="CELE_W07B3.2"
                     /standard_name="W07B3.2b"
                     /note="Product from WormBase gene class gei;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="GEX Interacting protein"
                     /protein_id="NP_497190.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00001561"
                     /db_xref="EnsemblGenomes-Tr:W07B3.2b.1"
                     /db_xref="EnsemblGenomes-Tr:W07B3.2b.2"
                     /db_xref="GeneID:175195"
                     /db_xref="GOA:H2L0F6"
                     /db_xref="UniProtKB/TrEMBL:H2L0F6"
                     /db_xref="WormBase:WBGene00001561"
                     /translation="MQQNIQYTYSSDPRSGGNQNQQLHGISQFQQNSYQPTTYSNSNA
                     NNFHSSNSATFIPNSVTQTPQRRMGEEKSLVNMLDAYFIDSTTPSTSTSWNNQQPVQM
                     SSIQQSVGSYNQQIPQLKVGDVDLQVEGMNVKLSSSPDKGEKDRVKKARQAEAARMRY
                     HRLSNEEKRELNLKRTLAQKRKRQREKEMEELESILRETNDIQEDPDITEQLREKRMR
                     AKWAEAARTRYARMTPEERRAHNTRRRMRQMQNAMSAIKACGMATGDPQKDDEAVRLH
                     IKTQNAKKAEAARQRYHRMNDDEKRVYNQRRTEAFRRRRMEEEMLLAMPIGRINGEAL
                     DRAQQIVVRNAKRAEAARLRYQRMTPDQRKVAKQEPKEESWPSHEQSDTQIDHDLDLG
                     DSYNQKRYTPKRRRNEMDDMISAGQMAVGSSGTITMGTGTPAKKDDMDALSSLERDVV
                     KRTQHAQQILLRQRANQSSGTPRSVTPPPQAYIISNGQQQHQQLVGNQGNNGIGQHQV
                     LHQGHMQQQQIQVSHQQSSQSIPQNIYTSGMIIQNQGQQQQGQQQQQGQSQQILNNPY
                     RT"
ORIGIN      
        1 atgcagcaga atatacaata cacatacagt tcggatcccc gctcgggcgg taatcaaaat
       61 cagcagctac acggaatatc gcaatttcaa cagaactcct atcagccgac gacgtattca
      121 aattcaaatg cgaacaattt tcattcctct aattccgcaa cttttatacc taattcagtg
      181 acgcaaacac ctcagcggcg gatgggagaa gagaagagtt tagttaatat gcttgacgct
      241 tattttatcg acagtacgac accttcaaca tcaacgtcgt ggaataatca gcagccagtt
      301 cagatgtctt caatacaaca atcagttgga tcatacaatc aacaaatacc tcagttgaaa
      361 gtaggagatg tggacctaca agtagaagga atgaatgtta aactctcctc gtcacccgac
      421 aaaggcgaga aggatcgagt aaagaaggcg cgacaggcag aagccgcccg aatgcgttat
      481 caccgactat caaacgaaga gaaacgagag ttaaacctga aaagaacgtt ggcgcagaag
      541 cgaaaacggc aacgtgagaa ggagatggag gagctcgaat cgattttgcg ggagacaaat
      601 gacattcaag aggatccgga catcaccgaa cagctcagag agaagagaat gcgggccaag
      661 tgggcagagg ccgcccgtac acgttacgct agaatgacgc cggaagagcg ccgggcgcac
      721 aatacgcgga gacgtatgcg gcagatgcag aacgcgatga gcgcgattaa ggcatgtgga
      781 atggctacag gagatccaca gaaggacgac gaggctgtcc ggttgcacat caagacgcag
      841 aatgcgaaaa aagcggaggc ggctcgtcaa cgataccatc gaatgaacga tgacgagaag
      901 cgcgtctaca atcaacgaag gacagaagcg ttccgccgcc gtcgtatgga agaagagatg
      961 ctgctcgcca tgcctatagg ccgtatcaac ggagaagcac tggatcgtgc tcagcagatt
     1021 gtggtccgaa acgcgaaacg agccgaagcg gcacgtcttc gctaccagcg aatgacgcct
     1081 gatcagagaa aggtcgcgaa acaagaaccg aaagaagagt cttggccctc tcatgagcaa
     1141 tctgacacgc aaatcgacca tgatctcgat ctcggagact cgtacaatca aaaacgctac
     1201 actccaaagc gtcgtcgcaa cgagatggac gacatgatca gcgccggaca gatggccgtc
     1261 ggatcctctg gaaccatcac aatgggcacc ggcacccccg ccaaaaagga cgatatggac
     1321 gctctctcct cgttggaacg tgacgtcgtc aagcgcacac agcacgctca gcagatcctt
     1381 ctccgacaac gcgcgaatca gtcgtcggga acgccacgct cggttacacc accgccacag
     1441 gcctatataa tctcgaatgg tcagcaacag caccaacagt tggttggaaa tcagggaaac
     1501 aatgggattg gacagcacca ggtgctccat caaggacaca tgcaacagca gcagattcag
     1561 gtgtcacacc agcagtcgtc ccaatcgatt cctcagaaca tctacacttc tggcatgatt
     1621 atccaaaatc agggacaaca gcaacaaggc cagcagcagc agcagggaca gtctcaacaa
     1681 atattgaaca atccttatag aacctaa
//