Dbfetch

LOCUS       NM_064787               1638 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans GEX Interacting protein (gei-4), partial
            mRNA.
ACCESSION   NM_064787
VERSION     NM_064787.4
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1638)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1638)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1638)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1638)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            On Jun 26, 2012 this sequence version replaced NM_064787.3.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1638
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>1638
                     /gene="gei-4"
                     /locus_tag="CELE_W07B3.2"
                     /db_xref="GeneID:175195"
                     /db_xref="WormBase:WBGene00001561"
     CDS             1..1638
                     /gene="gei-4"
                     /locus_tag="CELE_W07B3.2"
                     /standard_name="W07B3.2a"
                     /note="Product from WormBase gene class gei;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="GEX Interacting protein"
                     /protein_id="NP_497188.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00001561"
                     /db_xref="EnsemblGenomes-Tr:W07B3.2a.1"
                     /db_xref="EnsemblGenomes-Tr:W07B3.2a.2"
                     /db_xref="GeneID:175195"
                     /db_xref="GOA:H2L0F5"
                     /db_xref="UniProtKB/TrEMBL:H2L0F5"
                     /db_xref="WormBase:WBGene00001561"
                     /translation="MQQNIQYTYSSDPRSGGNQNQQLHGISQFQQNSYQPTTYSNSNA
                     NNFHSSNSATFIPNSVTQTPQRRMGEEKSLVNMLDAYFIDSTTPSTSTSWNNQQPVQD
                     LQVEGMNVKLSSSPDKGEKDRVKKARQAEAARMRYHRLSNEEKRELNLKRTLAQKRKR
                     QREKEMEELESILRETNDIQEDPDITEQLREKRMRAKWAEAARTRYARMTPEERRAHN
                     TRRRMRQMQNAMSAIKACGMATGDPQKDDEAVRLHIKTQNAKKAEAARQRYHRMNDDE
                     KRVYNQRRTEAFRRRRMEEEMLLAMPIGRINGEALDRAQQIVVRNAKRAEAARLRYQR
                     MTPDQRKVAKQEPKEESWPSHEQSDTQIDHDLDLGDSYNQKRYTPKRRRNEMDDMISA
                     GQMAVGSSGTITMGTGTPAKKDDMDALSSLERDVVKRTQHAQQILLRQRANQSSGTPR
                     SVTPPPQAYIISNGQQQHQQLVGNQGNNGIGQHQVLHQGHMQQQQIQVSHQQSSQSIP
                     QNIYTSGMIIQNQGQQQQGQQQQQGQSQQILNNPYRT"
ORIGIN      
        1 atgcagcaga atatacaata cacatacagt tcggatcccc gctcgggcgg taatcaaaat
       61 cagcagctac acggaatatc gcaatttcaa cagaactcct atcagccgac gacgtattca
      121 aattcaaatg cgaacaattt tcattcctct aattccgcaa cttttatacc taattcagtg
      181 acgcaaacac ctcagcggcg gatgggagaa gagaagagtt tagttaatat gcttgacgct
      241 tattttatcg acagtacgac accttcaaca tcaacgtcgt ggaataatca gcagccagtt
      301 caggacctac aagtagaagg aatgaatgtt aaactctcct cgtcacccga caaaggcgag
      361 aaggatcgag taaagaaggc gcgacaggca gaagccgccc gaatgcgtta tcaccgacta
      421 tcaaacgaag agaaacgaga gttaaacctg aaaagaacgt tggcgcagaa gcgaaaacgg
      481 caacgtgaga aggagatgga ggagctcgaa tcgattttgc gggagacaaa tgacattcaa
      541 gaggatccgg acatcaccga acagctcaga gagaagagaa tgcgggccaa gtgggcagag
      601 gccgcccgta cacgttacgc tagaatgacg ccggaagagc gccgggcgca caatacgcgg
      661 agacgtatgc ggcagatgca gaacgcgatg agcgcgatta aggcatgtgg aatggctaca
      721 ggagatccac agaaggacga cgaggctgtc cggttgcaca tcaagacgca gaatgcgaaa
      781 aaagcggagg cggctcgtca acgataccat cgaatgaacg atgacgagaa gcgcgtctac
      841 aatcaacgaa ggacagaagc gttccgccgc cgtcgtatgg aagaagagat gctgctcgcc
      901 atgcctatag gccgtatcaa cggagaagca ctggatcgtg ctcagcagat tgtggtccga
      961 aacgcgaaac gagccgaagc ggcacgtctt cgctaccagc gaatgacgcc tgatcagaga
     1021 aaggtcgcga aacaagaacc gaaagaagag tcttggccct ctcatgagca atctgacacg
     1081 caaatcgacc atgatctcga tctcggagac tcgtacaatc aaaaacgcta cactccaaag
     1141 cgtcgtcgca acgagatgga cgacatgatc agcgccggac agatggccgt cggatcctct
     1201 ggaaccatca caatgggcac cggcaccccc gccaaaaagg acgatatgga cgctctctcc
     1261 tcgttggaac gtgacgtcgt caagcgcaca cagcacgctc agcagatcct tctccgacaa
     1321 cgcgcgaatc agtcgtcggg aacgccacgc tcggttacac caccgccaca ggcctatata
     1381 atctcgaatg gtcagcaaca gcaccaacag ttggttggaa atcagggaaa caatgggatt
     1441 ggacagcacc aggtgctcca tcaaggacac atgcaacagc agcagattca ggtgtcacac
     1501 cagcagtcgt cccaatcgat tcctcagaac atctacactt ctggcatgat tatccaaaat
     1561 cagggacaac agcaacaagg ccagcagcag cagcagggac agtctcaaca aatattgaac
     1621 aatccttata gaacctaa
//