Dbfetch

LOCUS       NM_064599                717 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Chloride intracellular channel exl-1
            (exl-1), partial mRNA.
ACCESSION   NM_064599
VERSION     NM_064599.4
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 717)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 717)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 717)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 717)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003280).
            On Jun 26, 2012 this sequence version replaced NM_064599.3.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..717
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="II"
     gene            <1..>717
                     /gene="exl-1"
                     /locus_tag="CELE_F26H11.5"
                     /db_xref="GeneID:175100"
                     /db_xref="WormBase:WBGene00001371"
     CDS             1..717
                     /gene="exl-1"
                     /locus_tag="CELE_F26H11.5"
                     /standard_name="F26H11.5"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Chloride intracellular channel exl-1"
                     /protein_id="NP_497000.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00001371"
                     /db_xref="EnsemblGenomes-Tr:F26H11.5"
                     /db_xref="GeneID:175100"
                     /db_xref="WormBase:WBGene00001371"
                     /translation="MPTFSLWLPAGSNNVHPCGDPYAHHLFMRCLYHAKHDPTMKFDV
                     KTTNVNKTSQEFKNTGLRRMPGISAEESGETQTFETEDDILDFLEYLKPERGDDEEAE
                     NATCDLFRQFARFVKDVEHRDTAFNTELLRLDKYLSEQETKFLISDDVTHIDCLVLTR
                     LHSIRVAAKMLKNYEIPADLSHVLDYLKAGYATEMFRVSCPSDQEIVLHWTELKDTPR
                     LSAKDRAKLVREEPVFSFSV"
ORIGIN      
        1 atgcccactt tttcgctgtg gctgccagcg ggctctaata atgtacaccc gtgcggtgat
       61 ccgtatgctc accacctatt catgcgttgt ctgtaccacg caaaacacga tccaacgatg
      121 aaattcgatg tgaaaaccac aaatgtgaac aagacaagtc aagagttcaa aaacactgga
      181 ctccgtcgta tgcctggaat tagtgctgaa gagagcggag agacgcagac attcgagacg
      241 gaggacgata ttttggactt tttggagtac ttgaagcccg agagaggtga tgatgaagaa
      301 gcggagaatg ccacgtgtga tttgttccga caattcgcca gattcgtgaa ggatgtcgag
      361 catagggata cggctttcaa cacggaactc cttcgtctcg acaagtatct ctccgaacaa
      421 gaaaccaaat ttctgatctc cgatgacgtc acgcatattg attgcctggt cctgacgaga
      481 ttgcactcga tccgtgttgc cgcaaaaatg ctgaaaaact atgaaattcc agccgattta
      541 tcgcatgtac tcgactatct gaaagccggt tacgcgactg aaatgtttcg agtttcgtgt
      601 ccatccgatc aggaaattgt tcttcactgg acagagctca aggatacgcc ccgcttgtcg
      661 gctaaagacc gagctaaact ggtccgcgaa gagccggtat tttcattttc cgtctga
//