Dbfetch

LOCUS       NM_061983               4077 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Protein patched homolog 3 (ptc-3), partial
            mRNA.
ACCESSION   NM_061983
VERSION     NM_061983.6
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 4077)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 4077)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 4077)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 4077)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003280).
            On Jun 26, 2012 this sequence version replaced NM_061983.5.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..4077
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="II"
     gene            <1..>4077
                     /gene="ptc-3"
                     /locus_tag="CELE_Y110A2AL.8"
                     /db_xref="GeneID:173631"
                     /db_xref="WormBase:WBGene00004210"
     CDS             1..4077
                     /gene="ptc-3"
                     /locus_tag="CELE_Y110A2AL.8"
                     /standard_name="Y110A2AL.8a"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Protein patched homolog 3"
                     /protein_id="NP_494384.2"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004210"
                     /db_xref="EnsemblGenomes-Tr:Y110A2AL.8a"
                     /db_xref="GeneID:173631"
                     /db_xref="GOA:H2L0G5"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR003392"
                     /db_xref="UniProtKB/Swiss-Prot:H2L0G5"
                     /db_xref="WormBase:WBGene00004210"
                     /translation="MKVHSEQPPGKDEPGPIRRFLENRLIGNFDSEDFSDAWKKKFAH
                     APTWCDADMSLQQIKRGKAVGNTVALTARAFFQLWLFRIGCFVQRWAWSTIFISLFLY
                     CLCLGGLRHVTIETDLVKLWVSEGGRLNEEMGYLGQVKFERESGHLVHKVKRAVEQTT
                     EPPAPAVKAEVRRGPELPKENGLGGGFQVVIQTPSFDGQNILSKEALQQHTKLMEEIS
                     TYEVKMFNETWTLSDICFKPPGPSFNSGPLAGIMSKLLDKIIPCIWITPIDCYWDGAK
                     PLGPNPPLNLGPEVASFVSSLPPGNVTWKNLNPTSVIKEVGTLFDLGPIGNFFERAGI
                     DGAYLDRPCIDPLEEECPKSAPNYFDRCHALTKFNEWNMAKAMSEQVTLERKIIPKDD
                     GKSDIAETILNDIFGKKRRKRQADTTTKKPATKKDEDYYEYEDDADYLAGIANSTIAK
                     KNPEKEAKDLLCLEYGSSLLKWMQENPERLGEFLTKEEMPDYPNYGDVMTGGCKGFGK
                     KIMEWPEDLIIGGIQRDNGKLVSAEALQSVFLVSGAYDVFARIKNDKTDSHPGLDRHH
                     FQPWMAGEIISTWQRNFTKRLYSHELNRERRQFHPLASTSIADMLEEFSQFNYIIIVI
                     GYILMVIYAAFTQGRFQGWWLAVQSNVALAICGVILVTISSICGLGFATHLGINFNAA
                     TTQVVPFLSLGLGIDDMFLLLHNYDEIINICNKNEIGVLLKETGMSVMLTSINNILAF
                     ISGYVLPIPALRSFCSQTAILLAFNLIFLMFIFPAMIGIDLRRQRKGKRDLAYCSRGN
                     PQMATSQSVPSNVSNMSSRAELAGYEKQADEYKRHEPWYTVGGFLNKIYIPALKNNVV
                     KACVLIGTTTAVVFGLYGMYTSTLGLELADVLPEHTPPAAFLRAREQYFSFYPMFAVL
                     RGDKLDIPNQQQLIEEYRAQLGSSKFMIKAEGKLQPYWMSMLRVWLQSLDMALEKDLA
                     AGKFDLTNGNPIKVNGEKPSPESMIAARLVCSFGTNYNCDGRLGKMKMVENEVINPEG
                     FYNYLTGWFNVDNMMYYVSQASFYPTPPGWEYNEKLAKVVPAAEPLLYSQMPFYQNDL
                     IDTPAIVKMIEEIRATCEEYSERGLSNHPSGIAFTFWEQYLTLRWNLFQAICIIALAV
                     FCVISILMFNPWAATLIMCIVVITTIELGGFMGLMGIKMNPISAVTLICAVGIGVEFT
                     AHVELAFLTALGTIDQRLESCLQHMFVPVYHGAISTFLGVVMLVFSEFDFVVTYFFYT
                     MTLLVALGVFNGLCVLPVILTLVGPKPELTPTDGSSVLPPPPPLRQQYAEKSGGVEGG
                     MRKRKEKRPAEVEMSARDSPSTSSASHSSDDESSPAHK"
ORIGIN      
        1 atgaaggtgc attcggaaca accgcccggg aaggacgaac ccggtccgat cagaaggttt
       61 ctggaaaacc gcctgatcgg aaatttcgat tccgaagatt tctcagatgc gtggaagaaa
      121 aaattcgccc acgcgccgac ttggtgtgat gcagacatgt ctcttcagca gattaagcgg
      181 ggtaaagccg ttggaaacac cgttgcgctc accgccagag catttttcca attatggttg
      241 ttcaggatag gatgttttgt gcaacgatgg gcttggtcca ctatttttat cagtttattc
      301 ctctactgcc tctgcctcgg aggccttcgc cacgtcacaa tcgaaaccga tctcgtgaaa
      361 ctttgggtgt cagaaggtgg acggctgaat gaagaaatgg gatatctcgg ccaagttaaa
      421 tttgaacgag aatccggaca cctagtgcat aaagtgaaaa gagccgtcga acagactacg
      481 gagccgccgg caccggcagt gaaggcagaa gtccggcgtg gtcccgagct gccaaaggaa
      541 aacggattgg gaggaggttt tcaggtggta atccaaactc cgtccttcga tggtcagaat
      601 attctctcca aggaggctct gcagcagcat accaagttga tggaggaaat ttctacgtat
      661 gaagtgaaaa tgttcaatga aacctggacc ctctccgaca tctgcttcaa gccgccaggc
      721 ccatctttca acagtggccc gctggctgga atcatgtcca agctccttga caagatcatt
      781 ccatgcatct ggatcacacc gatcgattgc tattgggatg gtgcaaagcc actgggacca
      841 aatcctccgt tgaacttggg cccagaagtc gccagcttcg tgtcctccct cccacctggc
      901 aacgttacct ggaagaactt gaatccaaca tctgtcatca aagaggtcgg caccctattc
      961 gacttgggac ccatcggcaa ctttttcgaa agagccggta ttgacggagc ctacctcgac
     1021 aggccatgca ttgacccact ggaggaggaa tgcccaaagt ctgctccgaa ctacttcgat
     1081 aggtgtcatg cactgacaaa gtttaacgag tggaatatgg caaaggccat gagcgagcag
     1141 gtcaccctgg agcgcaaaat aatcccaaag gacgatggaa agtcagacat cgccgaaacg
     1201 attctcaacg acatttttgg aaagaagaga aggaagcgac aagcggatac tacgaccaag
     1261 aagcctgcca cgaaaaaaga cgaagactac tacgagtacg aagacgacgc ggactaccta
     1321 gcaggaatcg ccaactccac aatcgccaag aagaatccgg aaaaggaagc caaggacctt
     1381 ctgtgccttg agtacggaag ctcacttctc aagtggatgc aggagaatcc cgagagactc
     1441 ggcgagttct tgaccaagga ggagatgcca gattacccga actatggaga tgtgatgacc
     1501 ggtggatgta agggattcgg aaagaagatc atggagtggc cggaggactt gatcattgga
     1561 ggaatccagc gggacaatgg gaagttggtg tcagcagagg ccctgcaatc cgtgttcctg
     1621 gtctcaggag cctatgacgt gtttgccaga atcaagaacg acaaaaccga cagccacccc
     1681 ggccttgacc gccaccactt ccaaccatgg atggctggag agatcatcag cacgtggcag
     1741 agaaacttca ccaagcgact ctacagccat gagctcaacc gtgaacgccg tcagttccac
     1801 cccctagctt ccacctcaat cgctgacatg ctcgaggagt tctcccagtt caactacatc
     1861 atcatcgtca tcggatacat cttgatggtg atctacgccg cgtttaccca gggaaggttc
     1921 caaggatggt ggctggctgt gcagtcaaat gtggcattgg caatttgcgg agttatcctg
     1981 gttactatat catcgatttg tggattagga ttcgctactc atcttgggat caatttcaat
     2041 gcagcgacaa ctcaagttgt gccattcctt tccttaggtc taggaatcga tgatatgttc
     2101 ctccttctgc ataactacga tgaaatcatc aatatttgca acaaaaacga gatcggagta
     2161 ttgctaaaag agaccggaat gtctgtgatg ttgacctcta tcaacaacat tctcgccttc
     2221 atctcgggat acgttctccc gatccctgct ctacgatcct tctgctccca aaccgcgatt
     2281 ctccttgcct tcaacttgat cttcctcatg ttcatcttcc cagcaatgat cggaatcgat
     2341 ctgagaagac agcgaaaagg aaaaagagat ttggcctact gcagtcgagg aaacccacaa
     2401 atggcgacta gtcaaagtgt gccgagcaat gtttcaaata tgtcatcacg tgccgagttg
     2461 gctggctacg agaagcaggc cgacgagtat aagcgtcacg agccgtggta caccgtcgga
     2521 ggattcctca acaagatcta cattccggca ctcaagaata atgttgttaa ggcttgcgtt
     2581 ctcatcggaa ctaccaccgc cgtcgtcttc ggactctacg gaatgtacac ctcgactctc
     2641 ggtctcgagc tcgccgacgt gcttccagag cacaccccac cagcggcctt ccttcgtgct
     2701 cgcgagcaat acttctcctt ctacccgatg tttgcagttc ttcgtggtga caagcttgac
     2761 attccgaacc aacagcaact tatcgaagag tacagagcac agttgggatc ttcaaagttt
     2821 atgatcaagg ctgaaggtaa acttcaaccc tactggatgt ctatgctcag agtctggctg
     2881 caatctttgg acatggcctt ggaaaaagac ctcgccgctg gcaaattcga tttgacaaat
     2941 ggaaatccta tcaaggtgaa cggagagaag ccaagtcccg aatcgatgat cgcggctaga
     3001 cttgtatgct ccttcggcac caactacaac tgtgacgggc ggctcggaaa gatgaagatg
     3061 gtggaaaatg aggttattaa tccagaagga ttctataact atctgacggg atggttcaac
     3121 gttgacaaca tgatgtacta cgtgtcccag gcttcattct atccaacacc acctggatgg
     3181 gagtataatg agaagctcgc caaggtggtt ccggctgccg agccattgtt gtactcacag
     3241 atgccgtttt atcagaatga tttgatcgat acaccagcga ttgtaaaaat gattgaggaa
     3301 atccgtgcca cttgcgagga atactccgaa cgaggccttt ccaaccatcc atcgggtatc
     3361 gccttcacct tctgggagca atatcttact ttgagatgga acttgttcca agccatctgc
     3421 atcatcgcgc tcgccgtgtt ctgtgtcatt tcaattctaa tgttcaatcc atgggcagcc
     3481 actcttatca tgtgcatcgt agtgatcact accatcgagc tgggaggatt catggggctt
     3541 atgggcatca agatgaaccc gatttccgct gtaaccctca tctgtgccgt cggaatcggt
     3601 gtcgagttca ctgctcacgt cgagttggcc ttcctgacag ctctaggaac catcgatcaa
     3661 cgcctggagt cttgcctcca gcacatgttc gtgccagtct atcacggagc catctcaacg
     3721 ttcctcggag ttgtgatgct tgtgttctcc gagttcgact tcgtcgtcac ctacttcttc
     3781 tacacaatga cgttgctggt agcgttgggt gtgttcaacg ggttgtgtgt tcttccagtg
     3841 atccttacgc tggtcggccc gaagcctgag ctgacaccaa ccgatggtag cagtgtgctt
     3901 ccaccacctc caccattgcg gcagcagtac gctgagaaga gtggaggtgt ggaaggtggg
     3961 atgaggaaac ggaaggagaa gaggcctgcg gaggtcgaaa tgtcggctcg cgactctcca
     4021 tcaacatcct cagcgtccca ttcttctgat gacgagtcat cgccagcgca caagtaa
//