Dbfetch

LOCUS       NM_059159               1695 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Ezrin/Radixin/Moesin (erm-1), partial mRNA.
ACCESSION   NM_059159
VERSION     NM_059159.3
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1695)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1695)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1695)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1695)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003279).
            On Jun 26, 2012 this sequence version replaced NM_059159.2.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1695
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="I"
     gene            <1..>1695
                     /gene="erm-1"
                     /locus_tag="CELE_C01G8.5"
                     /db_xref="GeneID:172174"
                     /db_xref="WormBase:WBGene00001333"
     CDS             1..1695
                     /gene="erm-1"
                     /locus_tag="CELE_C01G8.5"
                     /standard_name="C01G8.5b"
                     /note="Product from WormBase gene class erm;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Ezrin/Radixin/Moesin"
                     /protein_id="NP_491560.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00001333"
                     /db_xref="EnsemblGenomes-Tr:C01G8.5b"
                     /db_xref="GeneID:172174"
                     /db_xref="GOA:G5EBK3"
                     /db_xref="InterPro:IPR000299"
                     /db_xref="InterPro:IPR000798"
                     /db_xref="InterPro:IPR008954"
                     /db_xref="InterPro:IPR011174"
                     /db_xref="InterPro:IPR011259"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR014352"
                     /db_xref="InterPro:IPR018979"
                     /db_xref="InterPro:IPR018980"
                     /db_xref="InterPro:IPR019747"
                     /db_xref="InterPro:IPR019748"
                     /db_xref="InterPro:IPR019749"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="InterPro:IPR035963"
                     /db_xref="UniProtKB/TrEMBL:G5EBK3"
                     /db_xref="WormBase:WBGene00001333"
                     /translation="MVAAGDINVRVTSMDSELEFAIQSSTTGKQLFDQVVKTIGLREI
                     WYFGLQYTDNKGFPTWLKLNKKVLSQDVKKDPTLVFKFRAKFYPEDVAEEIIQDVTMR
                     LFYLQVKDGILSDEIYCPPETSVLLASYAMQAKYGDYVPETHVAGCLTADRLLPQRVL
                     GQFKLNSEEWERRIMTWWADHRATTREQAMLEYLKIAQDLEMYGVNYFEIRNKKGTDL
                     YLGVDALGLNIYDKADRLSPKVGFPWSEIRNISFNDKKFVIKPIDKKAHDFVFYAPRL
                     RINKRILALCMGNHELYMRRRKPDTIEVQQMKQQAREDRALKIAEQEKLTREMSAREE
                     AEQRQRDAEKRMAQMQEDMERARLELAEAHNTIHSLEAQLKQLQLAKQALEQKEYELR
                     ELTAQLQSEKAMSDGERRHLRDQVDAREREVFSMREEVERQTTVTRQLQTQIHSQQHT
                     QHYSNSHHVSNGHAHDETATDDEDNGATELTNDADQNVPQHELERVTAAEKNIQIKNK
                     LDMLTRELDSVKDQNAVTDYDVLHMENKKAGRDKYKTLRQIRGGNTKRRIDQYENM"
ORIGIN      
        1 atggttgcgg ccggcgatat caatgtgcgt gtcacctcga tggactcgga gctcgagttc
       61 gctattcagt cgagcaccac aggaaagcaa ctttttgatc aggttgtcaa aaccattggt
      121 ctccgcgaga tctggtattt tggacttcag tacactgaca acaagggatt cccaacatgg
      181 ctgaaattga acaagaaagt cttgtctcag gacgttaaga aggacccgac tcttgttttc
      241 aaattccgcg ccaaattcta tccggaagat gtggccgagg agattatcca ggatgtcact
      301 atgcgtttgt tctatctcca agtgaaagat ggaattctgt cagatgagat ttattgtcca
      361 ccggaaacct ctgttcttct tgcctcttac gcgatgcaag ctaaatatgg agactatgtt
      421 ccagagacac atgtcgccgg atgtcttact gctgatcgtc tgcttcctca acgcgttctc
      481 ggacaattca aattgaacag tgaggaatgg gaacgccgta ttatgacatg gtgggcagat
      541 catcgtgcaa ctacacgtga acaagctatg cttgaatatt tgaaaattgc acaagatctc
      601 gagatgtatg gagtcaatta ctttgaaatc cgcaacaaaa agggaactga tctctatctt
      661 ggtgtcgatg ctcttggatt gaatatttac gataaagctg atcgtctttc gccgaaagtc
      721 ggattcccat ggtcggagat tcgtaatata tcattcaacg acaagaaatt tgtcatcaaa
      781 ccaattgata agaaggctca tgactttgtc ttctacgctc cacgactccg tatcaacaaa
      841 cgtattcttg ctttgtgtat gggaaatcac gagctttaca tgcgtagaag aaagccagat
      901 accattgaag ttcaacaaat gaagcaacaa gccagagagg atcgtgctct taagattgcc
      961 gagcaggaga agctcaccag agagatgtct gctcgcgaag aagccgaaca gcgtcaacgt
     1021 gacgccgaaa agcgtatggc tcaaatgcag gaagatatgg agagagctcg tcttgaattg
     1081 gctgaagcac acaatacaat tcactcattg gaggctcaac tcaagcaatt gcaattggct
     1141 aaacaagcat tggaacagaa ggaatacgaa cttcgtgagc tcactgctca acttcaatcc
     1201 gaaaaagcaa tgagtgatgg tgagagacgt catttgagag accaagttga tgctcgtgaa
     1261 cgtgaagttt tttcgatgag agaagaagtc gagagacaga ctactgttac aagacaactt
     1321 cagacacaga ttcactcgca acaacacact caacactact caaacagtca tcacgtttcc
     1381 aatggacacg ctcacgatga gactgccact gatgatgaag ataatggagc aactgaactc
     1441 acaaatgacg ctgatcagaa tgtgccacaa cacgagttgg agcgtgtcac agcagccgag
     1501 aagaacattc agatcaagaa taagctggat atgttgactc gcgagcttga cagtgttaaa
     1561 gatcagaacg ctgtcactga ctacgacgtt ctgcatatgg agaacaaaaa ggccggacgc
     1621 gacaagtaca agactctccg tcaaatccgt ggaggaaaca caaaacgaag aatcgatcaa
     1681 tacgaaaata tgtaa
//