Dbfetch

LOCUS       NM_001356754            3390 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Serine/threonine-protein kinase par-1
            (par-1), partial mRNA.
ACCESSION   NM_001356754
VERSION     NM_001356754.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3390)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3390)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3390)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3390)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3390
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            <1..>3390
                     /gene="par-1"
                     /locus_tag="CELE_H39E23.1"
                     /db_xref="GeneID:179912"
                     /db_xref="WormBase:WBGene00003916"
     CDS             1..3390
                     /gene="par-1"
                     /locus_tag="CELE_H39E23.1"
                     /standard_name="H39E23.1m"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Serine/threonine-protein kinase par-1"
                     /protein_id="NP_001343807.1"
                     /db_xref="GeneID:179912"
                     /db_xref="GOA:A0A2C9C376"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR033624"
                     /db_xref="UniProtKB/TrEMBL:A0A2C9C376"
                     /db_xref="WormBase:WBGene00003916"
                     /translation="MPDEEETSRLAWTKRLSRRLNKRSSSLIASLLGSRNGATSSKTI
                     NEPTTTEDELDEESMEEMKRRELIAARRASAAPNVENRVGNRHGGKEKSTSRRRSVDR
                     IYAYKVKEHVNTPPGDNQQKSSKENQKSNKDKQSSNQPPGQIPHSTNSGTRKSSGSGL
                     KTANLKHPARPSTESSTSSSHHRRPAQEMNGTSTATATGGGGTSGATTTASSGAPAAS
                     SGGSSARYSSSGRSHPTSGSSSSHARSTGQSGMSSRSAARRNDQDVHVGKYKLLKTIG
                     KGNFAKVKLAKHVITGHEVAIKIIDKTALNPSSLQKLFREVKIMKQLDHPNIVKLYQV
                     METEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYLHSKNIIHRDL
                     KAENLLLDQDMNIKIADFGFSNTFSLGNKLDTFCGSPPYAAPELFSGKKYDGPEVDVW
                     SLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLVINPQRR
                     SSLDNIMKDRWMNVGYEDDELKPFIEPPKDQIDEQRIEKLIQIFQLGFNKAAILESVE
                     KEKFEDIHATYLLLGERKSDMDASEITMAQSLLSHSSINVSSSLGQHPAGVITREHVT
                     SSSASGSSASPSRYSRSSATATGASITAGSALASAANAQKHQQSSAAPSSGSSSSRRS
                     SQNDAAATAAGGTVVMSGTRHGGVQMRAQPTSRQATISLLQPPSYKPSSNTTQIAQIP
                     PLFNRNSTATSSAAQPSTGITGTRKIADPKGRIPLNSTAVQGHRTATGAVAANNGGIP
                     SHRDHAQQQQYMNQLTSSTMMSKLINKTPAAGGTAATSSSSSSSATSTAPLQKSGSQI
                     SHAPTEPVIREDDDENNSENQNGNVPLIGGVGPQTSPAVQVPTEDATSSSDKEQQQQK
                     ASSETPKESNPIVWQNLHLNSLLKSLLDSSAATSYETPRRPGIAGRRSEPSAATPRRR
                     HQTMVVDARHLQTPPDTDRPYHFEDTTLDRQMRALYVSTASSRMTRGVLPTPPTSNST
                     SSSFIVEPLTHVAAASPDITTTTPTKSTVTTSPYFRRTPSFRMAVDDPPISINASITD
                     DDCDGIIEIEREWSNGGTDSGDGRSTTTSHITANVSFGNNQ"
ORIGIN      
        1 atgccggatg aagaagaaac ttctcgttta gcatggacca agcgtctatc tcgtcgattg
       61 aacaaacgaa gttcatctct aatcgcttca ctgcttggca gtagaaatgg agcaacttca
      121 agtaaaacaa taaatgagcc aacaactact gaagatgaat tggatgaaga aagtatggaa
      181 gaaatgaaga gaagagagtt gatagctgca agaagagcat ctgctgctcc aaatgttgaa
      241 aatcgagtcg gaaatcggca tggtggaaag gagaaaagta cgtcgagacg gagaagtgtt
      301 gatcgcattt atgcttataa ggttaaggag catgtgaaca cgcctccagg ggataatcag
      361 cagaaatcat cgaaagaaaa ccagaaatct aataaggata aacagtcgtc aaatcagcca
      421 cccggtcaaa ttccgcattc aacaaatagc ggaacaagga aatcgagtgg aagcggattg
      481 aaaactgcaa atttgaaaca tccggcgcgc ccatcaacag aatcctcaac ttcttcatca
      541 catcatcgac gtcctgcaca agaaatgaac ggaacgtcga cggcaactgc caccggtggc
      601 ggaggaacat ctggagccac cacaacggca tcatcaggag caccggctgc ttcatcgggt
      661 ggaagctcgg ctagatattc gagtagtggg agatcccatc caacgtctgg aagctcttca
      721 tcacatgcac gatctactgg acaatcgggt atgtcaagtc gatcggcagc acgacgcaac
      781 gatcaggatg tacacgttgg aaagtataag ctattgaaga ctattggaaa gggaaatttt
      841 gcaaaggtaa aactcgcaaa gcacgtgata accggacatg aagtcgctat aaaaattatc
      901 gacaagactg ctctgaaccc atcgagtctt caaaaattgt tccgagaagt gaaaattatg
      961 aaacaattgg atcatccgaa tattgtgaaa ttatatcaag tgatggaaac tgaacagaca
     1021 ctgtatttag tactcgaata tgcatccggt ggtgaagtat ttgattattt ggttgcacac
     1081 ggaagaatga aagagaaaga agcaagagcc aaatttcgac aaattgtctc tgctgttcaa
     1141 tatttgcatt cgaaaaatat aattcatcga gatttgaaag ctgaaaattt gcttctcgat
     1201 caagatatga atattaaaat tgctgatttt ggattttcga ataccttctc acttggaaac
     1261 aaactcgaca cattttgtgg atctccaccg tacgctgctc cagaattatt ttccggtaaa
     1321 aagtacgatg gtcctgaagt agatgtttgg agtcttggtg taattctcta tactcttgta
     1381 tccggaagtc taccatttga tggacaaaat ttgaaagagc ttcgagaacg tgtgctccgt
     1441 ggaaaatacc gtatcccgtt ctatatgtca acggattgtg agaatttgtt gaagaaattc
     1501 cttgttatca atccacaaag gagatcatca ttggataata ttatgaaaga tcgatggatg
     1561 aatgtgggat atgaagatga tgagcttaag ccatttattg agccaccaaa agatcaaatt
     1621 gatgaacaga gaattgagaa attgattcag atcttccaac tcggattcaa caaagccgcc
     1681 attttggaaa gcgtcgagaa ggaaaagttt gaagatattc atgcaacgta tttgctttta
     1741 ggagaacgaa aatctgatat ggatgccagt gaaatcacaa tggcccaatc actgctcagc
     1801 cattcgtcaa tcaatgtttc gtcgtctctg ggtcagcacc cggccggtgt tatcactagg
     1861 gagcatgtga cgtcatcatc agcgtctgga agctctgctt caccatcccg atactctcga
     1921 tcctcagcaa cagccacagg tgcatcaatc actgcaggat cagcgctcgc atcggctgcg
     1981 aatgctcaga aacatcagca atcatcggca gctccatcgt caggatcttc gtcgtcgagg
     2041 agaagctcgc aaaacgatgc ggcagcgacg gcggctggtg gtactgtagt gatgagtgga
     2101 acaaggcatg gtggagttca gatgagagct cagccgacga gtcggcaagc gacaatcagt
     2161 ttattgcaac cgccgagtta taagccttcc tccaacacca cgcaaattgc tcaaattccg
     2221 ccactattca atagaaactc aacggcaacc tcatcagctg ctcaaccttc aacaggaatc
     2281 accggtactc gaaagattgc tgatccaaaa ggacgaattc cgctcaattc gactgctgta
     2341 caaggacatc gaactgcaac aggtgcagtt gcagccaata atggtggtat tccaagtcat
     2401 cgggatcatg ctcagcagca gcagtatatg aatcaactca cctcgtcgac aatgatgtca
     2461 aagctcatca ataagactcc agcggctggt ggtactgcag ccacgtcatc ttcttcctca
     2521 tcgtctgcca cgtcgacagc gccacttcag aaatctggat cacaaatctc gcacgcaccg
     2581 actgaaccag tcattcgaga agacgacgac gagaataaca gtgagaatca gaatggaaat
     2641 gttccattga tcggaggtgt cggaccacaa acctctccag ctgttcaagt accaacagaa
     2701 gatgcaactt catcatcaga caaggaacaa cagcagcaga aagcatccag tgagacaccc
     2761 aaagagtcca acccgatcgt ctggcagaat ttgcatctca acagtcttct gaaatctttg
     2821 ttggattctt cggcagctac atcatatgaa actccacgga ggccaggaat agctggaaga
     2881 cgttcggaac catcagcagc aacgcctcgg cgacgtcatc agacaatggt ggttgatgcg
     2941 cgacatcttc agacacctcc agacactgat agaccgtatc attttgaaga tacgacgctt
     3001 gatcgtcaga tgagagcact ctacgtctca actgcttcgt caagaatgac acgtggtgta
     3061 cttccaactc cacccacctc gaattccacg tcatcgagct ttattgtgga accgttgaca
     3121 catgttgctg ctgcatcacc agatattact acaacaacac cgacgaagtc aactgtgacg
     3181 acgtcgccat attttaggcg aacaccgtca tttcgaatgg ccgtcgatga tccaccaatc
     3241 tccatcaatg cctccatcac agatgatgac tgcgatggaa tcattgaaat tgagcgagag
     3301 tggtcaaacg gggggaccga cagtggcgac gggaggtcca ccacaacgag ccacatcaca
     3361 gcaaatgtct cgttcggcaa caaccaatag
//