Dbfetch

LOCUS       NM_001330913            3903 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Apical junction molecule (ajm-1), partial
            mRNA.
ACCESSION   NM_001330913
VERSION     NM_001330913.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3903)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3903)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3903)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3903)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003284).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3903
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="X"
     gene            <1..>3903
                     /gene="ajm-1"
                     /locus_tag="CELE_C25A11.4"
                     /db_xref="GeneID:181148"
                     /db_xref="WormBase:WBGene00000100"
     CDS             1..3903
                     /gene="ajm-1"
                     /locus_tag="CELE_C25A11.4"
                     /standard_name="C25A11.4i"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Apical junction molecule"
                     /protein_id="NP_001317898.1"
                     /db_xref="GeneID:181148"
                     /db_xref="GOA:A0A1C3NSL9"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="InterPro:IPR038825"
                     /db_xref="UniProtKB/Swiss-Prot:A0A1C3NSL9"
                     /db_xref="WormBase:WBGene00000100"
                     /translation="MMPTTTSTYHHVETPSDEYYRREVMTRTIITRSTEALSQTPLGR
                     PASPLDRYLPYPTTTTTTSGDGRTREEKTVDYKVTYHRDIEEQERRIREDQARRQQEE
                     QDRRDREDNARRILAQREHQEMERLREQQNLSERALAERERADKERLQQERLLRQQRE
                     KKRREEWDRLESIRLAEEEAELARRRALEKERIDREKAEEERKTMERLERERARLERE
                     RLEEERRQKEKAETERIERERREHERIEIERIERIKRERIERERREREEKKAEEDRLL
                     RERLELERIERERRELEARERQELELQRREAEDRERQRLEDEAREMRRREEERREAEL
                     VADVHRQAEERERLRKRQEREEAERLERIRLEQQKIDMERIDAERRERERKEEERREF
                     ELIEAARRKKEARDRDRLDEMERERVREEEERREKERREQERRIAAEKERKRRQEEEE
                     EIARLNELQRAAAARQAQRNAELDRQRQRDELDRKAQELSEREMREKERRDRERANEE
                     AQLADLLERERHNQLIRENERREAVERANNRRLEDRRSRDKLDHIVRERSEKEQFELE
                     KRRLLAEKEAMNRKKNHLLSSETLAKLTQPMYYTTREPEVTTKVERQVIERIDRNVWV
                     EDVPYAPSQSAMGYLDNDENNRDRLYNPNDLNRNGSSRSRYQRAKNEKARRDFYHSSQ
                     DSADPVTERFRKSTDDLTTRSRPEYRGPLLQKFHDSEFRTTALNETDGLPYRRMGPSP
                     YEQPFAKLLEETERRYAHYNSRASNPSIYQSSRYYYPERHGQPQHTDNTRAESVVAYE
                     RESRRESPADQAHIRSRSADYLMDRRIREETEVPENQLQKTRVEPHDQSPRESRISEY
                     EMRFRKSTEKLTVPDWYRENRPQGQTAQTSTYRYGNGVEPMSTTTTTTTVINGTSSHQ
                     QAPPPVPPQPIGNIGLPRGMFDRYKDDIEELRRSRSSLHQTGQQETSNRQGSTLSVGG
                     IVDQGHALPGYTVSEVPNAWNLHTSRTSRVVEVADTFVGTSSHEYGNFTNRYGGRVTI
                     EEVLDSIFQKVTPTNQRLNFDRSYPQADELFQGNVDGPGIYTNNYSVMRQVLKSPERA
                     EHILQNEELFVRCTECHRTRELSAARLFFVSCKHCYTYYCSRECRHNNWPNHSGRCSF
                     ARINTLCKDVIMKVREDEQAQAFMSKVARDGFSVSGRGSVNIRLSSPQLAQAYVSNGW
                     RALSAYPNDQLLYYYTVKALIAERKEPSLIALCNRYEPREKFILSVSIIADIEHCPET
                     PPPETRELSAVQFSSPRSRYEAIQNQNAPYFSEFAHNV"
ORIGIN      
        1 atgatgccaa caacaacctc cacataccat catgtggaga caccatcgga cgagtactac
       61 cgacgagaag tgatgacaag aacaattatt actagaagca cagaagcatt gtcacaaaca
      121 cctctcggaa gacctgcatc acctctggac agatatcttc catacccgac cacaacaaca
      181 actactagcg gtgacggcag aactcgcgag gagaaaaccg ttgattataa ggtcacttat
      241 caccgagaca ttgaagaaca ggagcgtaga atcagagagg atcaagcacg gcgtcaacag
      301 gaagagcagg atcgtcgtga tcgtgaagat aatgccagaa gaatattagc acaaagagaa
      361 catcaagaaa tggaacgtct tcgtgagcag cagaaccttt ctgaaagagc acttgctgaa
      421 cgagagcgcg cagacaaaga acgtcttcaa caagaacgtc ttctccgcca acaacgtgaa
      481 aagaaacgtc gtgaagaatg ggatcgcctt gagagcatac gtctagctga ggaagaagca
      541 gaacttgcac gacgcagagc actcgaaaaa gagcgcattg atcgtgaaaa agctgaagaa
      601 gagagaaaaa caatggaacg tcttgaaaga gagcgtgctc gtttggaaag agaacgtctc
      661 gaagaagaac gtcgccaaaa ggagaaagcc gagacggaga gaattgaacg tgaaagacgt
      721 gaacacgaaa gaatagaaat cgaacgtatc gaaagaatca aaagagaaag aatagaacgg
      781 gagcgtcgtg agcgtgaaga gaaaaaggca gaggaggacc gtctgcttcg agaacgtctt
      841 gaattggaac gaatcgagcg tgaacgtcgc gagctggaag ctcgagagcg tcaggaactt
      901 gagcttcaac gtcgtgaagc tgaagaccgg gaacgccaac gtctcgaaga tgaggctcgc
      961 gagatgcgcc gtcgtgaaga agagcgccga gaagcagaat tggttgcaga tgtccataga
     1021 caagctgaag aacgtgaacg actccgcaag cgtcaagagc gtgaagaggc tgaacgtttg
     1081 gaaagaatcc gtcttgagca gcagaagatt gacatggaaa gaattgacgc tgaacgacga
     1141 gaacgggaga gaaaagaaga agagcgacga gaatttgagc ttattgaagc agcaagacgg
     1201 aagaaggaag ctcgtgatcg tgatcgtctt gatgagatgg aacgcgagcg cgtaagagaa
     1261 gaagaagagc gcagagaaaa ggagcgccgt gaacaagaac gtagaattgc cgctgagaaa
     1321 gagcgcaaga gaagacaaga agaggaggaa gaaattgctc gtctgaatga acttcaaaga
     1381 gctgctgctg ctcgccaagc ccaacgtaac gcagaacttg accgccaaag acagcgtgat
     1441 gagctggacc gaaaggccca agagctttcg gagcgggaaa tgcgagaaaa ggaacgtcgt
     1501 gatcgtgaac gagccaatga agaggctcaa ctagctgatc ttttggaacg tgaacgccac
     1561 aatcaactca ttcgtgaaaa cgagcgaaga gaagctgttg agcgtgccaa caatcgtcgt
     1621 ctggaagaca gaagatcacg cgacaagttg gatcacattg tacgtgaaag atccgaaaag
     1681 gagcaatttg aactcgagaa gcgcagactt cttgccgaga aggaggcaat gaacagaaag
     1741 aaaaaccatc tgttgagcag tgaaactctt gcaaaactta ctcagccaat gtactacacg
     1801 actcgcgaac cagaagtcac cactaaagtg gaaagacaag ttatcgagcg tattgaccgt
     1861 aacgtatggg ttgaggatgt gccatatgct ccaagccaga gtgccatggg ttatttggat
     1921 aatgacgaga acaaccgtga tcgtctttac aacccgaatg atttgaatag aaacggatcc
     1981 agcagaagcc gctaccaacg tgccaaaaat gagaaagccc gccgcgactt ctaccattca
     2041 tcacaggatt ccgcagatcc agttactgag cgttttcgta aatccactga tgacttaaca
     2101 actcgttctc gcccagaata tcgtggccca ttgcttcaaa agttccatga ctctgaattc
     2161 cgaaccaccg ctctaaatga aaccgacggt ttgccatatc gcagaatggg gccaagtcca
     2221 tatgagcagc cgttcgcgaa acttctcgaa gaaaccgaaa gacgctacgc tcattacaac
     2281 agccgtgcca gcaacccgtc tatttaccag tcaagccgtt attactatcc ggagaggcat
     2341 ggacagccac agcacacgga caatactcgt gccgagtccg tagttgccta cgaacgtgag
     2401 agccgccgtg aatcaccagc agaccaagct cacatcagaa gccgttctgc agattatctc
     2461 atggatagaa gaatccgtga agaaaccgag gttccagaga accaacttca aaaaactcgc
     2521 gtggaacctc atgatcagtc accacgggaa tctcgtattt cagaatatga aatgcgcttc
     2581 cgcaaatcaa ccgagaagct aaccgttcct gactggtacc gtgaaaacag accacagggt
     2641 caaactgctc aaacttcaac ctaccgatat ggaaatggag ttgagccaat gagcaccaca
     2701 acaacaacca ctactgttat taatggaaca tcttctcatc agcaagcacc ccctccagta
     2761 ccaccacaac caattggaaa cattggactg ccgcgtggca tgtttgatag atacaaggat
     2821 gacattgaag agctccgacg ctcccgctca tcacttcatc aaactggtca acaggaaacg
     2881 tcgaaccgac agggatcaac gctgagtgtg ggtggcattg tcgatcaagg acacgctctc
     2941 ccaggctaca cagtgtcaga agtgccgaat gcgtggaacc tgcatactag ccgcacttct
     3001 cgtgtcgtcg aggtcgccga cacgtttgtc ggtacttctt cacatgaata cggaaacttc
     3061 acaaatcgtt acggaggccg agttacaata gaagaagtgc tcgactcaat cttccagaag
     3121 gtgactccaa cgaatcagag actaaatttt gacaggagtt acccacaagc tgacgagtta
     3181 ttccaaggaa acgttgatgg cccaggaatt tatacgaaca actatagcgt gatgcgtcaa
     3241 gtgctcaaat cgccagaaag agctgagcac attctacaaa atgaggagtt attcgttaga
     3301 tgtactgaat gtcacagaac cagagaacta tccgcagcta gactcttttt tgtgtcctgc
     3361 aagcactgct acacatacta ctgctctaga gaatgcaggc ataacaattg gccaaaccac
     3421 tcgggaagat gttcttttgc acgaattaat acattatgta aagatgttat catgaaagtt
     3481 cgagaggatg aacaggctca agctttcatg tcgaaagtcg ccagagacgg tttttcagtt
     3541 agtgggagag gaagtgtgaa tattcgtctg tcatccccac aactcgcaca ggcatacgtc
     3601 agcaacggat ggagagcact ttccgcttat ccaaatgacc aacttctcta ttactacact
     3661 gtcaaagctt tgattgctga aaggaaagaa ccttctttga ttgccctttg taatcggtat
     3721 gaaccaagag aaaagttcat tctttccgtg tctatcattg ctgacatcga gcactgccca
     3781 gagactccac ctccagagac acgcgaactc tcagccgtcc aattctcctc tcctagatcc
     3841 cgctacgaag ccattcagaa tcaaaatgct ccatacttct cagaatttgc acacaatgtc
     3901 tag
//