Dbfetch

LOCUS       NM_001330907            3882 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Apical junction molecule (ajm-1), partial
            mRNA.
ACCESSION   NM_001330907
VERSION     NM_001330907.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3882)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3882)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3882)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3882)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003284).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3882
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="X"
     gene            <1..>3882
                     /gene="ajm-1"
                     /locus_tag="CELE_C25A11.4"
                     /db_xref="GeneID:181148"
                     /db_xref="WormBase:WBGene00000100"
     CDS             1..3882
                     /gene="ajm-1"
                     /locus_tag="CELE_C25A11.4"
                     /standard_name="C25A11.4b"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Apical junction molecule"
                     /protein_id="NP_001317733.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00000100"
                     /db_xref="EnsemblGenomes-Tr:C25A11.4b"
                     /db_xref="GeneID:181148"
                     /db_xref="GOA:H2KYC5"
                     /db_xref="UniProtKB/TrEMBL:H2KYC5"
                     /db_xref="WormBase:WBGene00000100"
                     /translation="MDIENLQSSNNRSQKSRPPDGFNAILQTAFSAILAFVLSLRIIV
                     FATARKRLTTTAANPDIQVEEASSSSSDTSSDTEIVEEGVFIQRQGEPTMSEKKPAQG
                     MPSVMSLLQTDEILSSCSDDEPTTSGLIPLPSLIQSNMSVLPNFLHTINEEESDEIRS
                     LTGSSLASPRTVVDRRLSNISLLSPTPDEDFGLEQQEQQPENSEEVRGRESRTSLEEE
                     RIVVGEPRTTRQIEITQSASEDDRLDLLKELAKIGKSNTSTSQMSTTTPEKPEEIIDA
                     TGTSDTAEKIEVVISKEEPAEQKNEVEEPDYAQVPAESEDDAAQELAPTDSAIQVVHV
                     LEAPQKAELVTIPLAHSEAEDHKLADADRDQEEELVFNEERRKTVTMDDNASLRSASI
                     TFDANRDEQDLLNESFASNPTDETVLMQKTKDEMDATSERPRSPLDLPPPPASVVLHP
                     SAPPPPPPPLSSTEVVGNTTTTTTTHYAPKTWNDPSITTAPKIPVSLLSGAQPLPSVL
                     TQRTTTSSYSAPNYSASSMSGVPSDVAPPPPLPIPNQSSSSAASYQHHHASSISKSIS
                     SSREDLLSEHATSRSTVREIPVHRAPSTAPSHSSVFEYHMMPTTTSTYHHVETPSDEY
                     YRREVMTRTIITRSTEALSQTPLGRPASPLDRYLPYPTTTTTTSGDGRTREEKTVDYK
                     VTYHRDIEEQERRIREDQARRQQEEQDRRDREDNARRILAQREHQEMERLREQQNLSE
                     RALAERERADKERLQQERLLRQQREKKRREEWDRLESIRLAEEEAELARRRALEKERI
                     DREKAEEERKTMERLERERARLERERLEEERRQKEKAETERIERERREHERIEIERIE
                     RIKRERIERERREREEKKAEEDRLLRERLELERIERERRELEARERQELELQRREAED
                     RERQRLEDEAREMRRREEERREAELVADVHRQAEERERLRKRQEREEAERLERIRLEQ
                     QKIDMERIDAERRERERKEEERREFELIEAARRKKEARDRDRLDEMERERVREEEERR
                     EKERREQERRIAAEKERKRRQEEEEEIARLNELQRAAAARQAQRNAELDRQRQRDELD
                     RKAQELSEREMREKERRDRERANEEAQLADLLERERHNQLIRENERREAVERANNRRL
                     EDRRSRDKLDHIVRERSEKEQFELEKRRLLAEKEAMNRKKNHLLSSETLAKLTQPMYY
                     TTREPEVTTKVERQVIERIDRNVWVEDVPYAPSQSAMGYLDNDENNRDRLYNPNDLNR
                     NGSSRSRYQRAKNEKARRDFYHSSQDSAGLA"
ORIGIN      
        1 atggacatag aaaatctaca atcgtcaaac aacaggtcac agaaaagtcg tcctccggac
       61 ggcttcaacg ccatcttaca gacagcattt tctgctattt tggcgtttgt cctctctcta
      121 cgtataattg tgttcgccac ggcccggaaa cgacttacca ccacggcggc aaatccggat
      181 attcaggttg aggaggcgtc gtcttcctca tccgatacca gctccgacac cgaaattgta
      241 gaagagggtg tatttataca gagacaaggg gaaccaacca tgtcagagaa aaaaccggca
      301 caaggaatgc cgtccgtaat gtcgctgctt caaactgacg aaattttgtc atcatgctca
      361 gatgacgaac caaccacatc cggactcatt ccattgccat ccttgattca atcaaacatg
      421 agcgtcctgc caaactttct tcacactatt aacgaggaag aatctgacga gatccgttct
      481 ctcaccggaa gcagtctagc atctccgaga acagtcgttg accgtcgttt atccaacatc
      541 tccttgctta gtcccacgcc tgacgaggat ttcggactag aacagcagga acaacaacca
      601 gaaaatagtg aagaggtgcg cggtagagag agtagaacca gcttagaaga agaacgaatt
      661 gttgttggcg agccacggac tacgcgtcaa atcgagatta cacagtctgc ttcggaagac
      721 gatcgacttg atttgctcaa ggagcttgcc aagattggaa agtcaaatac ttctacaagc
      781 cagatgagca caacgacacc tgaaaaacca gaagaaatca ttgacgccac tggcacaagt
      841 gacaccgccg aaaagatcga agtagtgatc tcaaaggaag aaccggcaga acaaaagaat
      901 gaagtcgaag agcccgatta tgctcaagtt ccagccgaat cagaggatga tgcagctcaa
      961 gaacttgcac caactgacag cgcaatacaa gtagttcatg ttttagaagc accacaaaag
     1021 gcagagttag tgaccatccc actagcacat agtgaagcag aagatcacaa actcgccgac
     1081 gccgatcgtg atcaagagga agaactggtt ttcaacgagg agcgccgcaa aacagtgacc
     1141 atggacgaca acgcttcact tcgctctgca tctatcacat ttgacgcaaa tcgcgacgag
     1201 caagatttgt tgaacgaatc ttttgcttca aacccaactg atgagacagt gttgatgcaa
     1261 aaaaccaagg acgaaatgga tgcaaccagc gagcgtccaa gatcaccatt agaccttcca
     1321 cctccaccag catcagttgt tcttcatccg tctgctcctc caccgccacc gcctccattg
     1381 agctcgacag aagttgttgg aaatactacc actacaacta cgacgcacta cgctccaaaa
     1441 acgtggaacg atccgtccat cacaactgct ccaaaaattc cagtttcctt actgtcagga
     1501 gcacaaccac tgccaagtgt tttaacacaa agaaccacta caagctctta cagtgctcca
     1561 aattattcag cttcttcaat gagtggtgtt ccgagtgatg ttgcgccgcc tccaccgcta
     1621 ccgatcccga atcagtcgtc atcatctgca gccagctatc aacaccatca cgcatcttct
     1681 atctcaaagt caatcagttc gtcccgcgaa gatcttctct cggaacacgc gacgtctcga
     1741 tccactgttc gcgagatccc ggtgcatcgc gcgccgtcaa cggcaccctc gcacagcagc
     1801 gtctttgaat accatatgat gccaacaaca acctccacat accatcatgt ggagacacca
     1861 tcggacgagt actaccgacg agaagtgatg acaagaacaa ttattactag aagcacagaa
     1921 gcattgtcac aaacacctct cggaagacct gcatcacctc tggacagata tcttccatac
     1981 ccgaccacaa caacaactac tagcggtgac ggcagaactc gcgaggagaa aaccgttgat
     2041 tataaggtca cttatcaccg agacattgaa gaacaggagc gtagaatcag agaggatcaa
     2101 gcacggcgtc aacaggaaga gcaggatcgt cgtgatcgtg aagataatgc cagaagaata
     2161 ttagcacaaa gagaacatca agaaatggaa cgtcttcgtg agcagcagaa cctttctgaa
     2221 agagcacttg ctgaacgaga gcgcgcagac aaagaacgtc ttcaacaaga acgtcttctc
     2281 cgccaacaac gtgaaaagaa acgtcgtgaa gaatgggatc gccttgagag catacgtcta
     2341 gctgaggaag aagcagaact tgcacgacgc agagcactcg aaaaagagcg cattgatcgt
     2401 gaaaaagctg aagaagagag aaaaacaatg gaacgtcttg aaagagagcg tgctcgtttg
     2461 gaaagagaac gtctcgaaga agaacgtcgc caaaaggaga aagccgagac ggagagaatt
     2521 gaacgtgaaa gacgtgaaca cgaaagaata gaaatcgaac gtatcgaaag aatcaaaaga
     2581 gaaagaatag aacgggagcg tcgtgagcgt gaagagaaaa aggcagagga ggaccgtctg
     2641 cttcgagaac gtcttgaatt ggaacgaatc gagcgtgaac gtcgcgagct ggaagctcga
     2701 gagcgtcagg aacttgagct tcaacgtcgt gaagctgaag accgggaacg ccaacgtctc
     2761 gaagatgagg ctcgcgagat gcgccgtcgt gaagaagagc gccgagaagc agaattggtt
     2821 gcagatgtcc atagacaagc tgaagaacgt gaacgactcc gcaagcgtca agagcgtgaa
     2881 gaggctgaac gtttggaaag aatccgtctt gagcagcaga agattgacat ggaaagaatt
     2941 gacgctgaac gacgagaacg ggagagaaaa gaagaagagc gacgagaatt tgagcttatt
     3001 gaagcagcaa gacggaagaa ggaagctcgt gatcgtgatc gtcttgatga gatggaacgc
     3061 gagcgcgtaa gagaagaaga agagcgcaga gaaaaggagc gccgtgaaca agaacgtaga
     3121 attgccgctg agaaagagcg caagagaaga caagaagagg aggaagaaat tgctcgtctg
     3181 aatgaacttc aaagagctgc tgctgctcgc caagcccaac gtaacgcaga acttgaccgc
     3241 caaagacagc gtgatgagct ggaccgaaag gcccaagagc tttcggagcg ggaaatgcga
     3301 gaaaaggaac gtcgtgatcg tgaacgagcc aatgaagagg ctcaactagc tgatcttttg
     3361 gaacgtgaac gccacaatca actcattcgt gaaaacgagc gaagagaagc tgttgagcgt
     3421 gccaacaatc gtcgtctgga agacagaaga tcacgcgaca agttggatca cattgtacgt
     3481 gaaagatccg aaaaggagca atttgaactc gagaagcgca gacttcttgc cgagaaggag
     3541 gcaatgaaca gaaagaaaaa ccatctgttg agcagtgaaa ctcttgcaaa acttactcag
     3601 ccaatgtact acacgactcg cgaaccagaa gtcaccacta aagtggaaag acaagttatc
     3661 gagcgtattg accgtaacgt atgggttgag gatgtgccat atgctccaag ccagagtgcc
     3721 atgggttatt tggataatga cgagaacaac cgtgatcgtc tttacaaccc gaatgatttg
     3781 aatagaaacg gatccagcag aagccgctac caacgtgcca aaaatgagaa agcccgccgc
     3841 gacttctacc attcatcaca ggattccgca ggtctggcat ga
//