Dbfetch

LOCUS       NM_001318311            2136 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Ubiquitin-like protease 2 (ulp-2), partial
            mRNA.
ACCESSION   NM_001318311
VERSION     NM_001318311.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 2136)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 2136)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2136)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 2136)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003280).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..2136
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="II"
     gene            <1..>2136
                     /gene="ulp-2"
                     /locus_tag="CELE_Y38A8.3"
                     /db_xref="GeneID:173859"
                     /db_xref="WormBase:WBGene00006737"
     CDS             1..2136
                     /gene="ulp-2"
                     /locus_tag="CELE_Y38A8.3"
                     /standard_name="Y38A8.3b"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Ubiquitin-like protease 2"
                     /protein_id="NP_001305240.1"
                     /db_xref="GeneID:173859"
                     /db_xref="GOA:A0A0S4XR45"
                     /db_xref="InterPro:IPR003653"
                     /db_xref="InterPro:IPR038765"
                     /db_xref="UniProtKB/TrEMBL:A0A0S4XR45"
                     /db_xref="WormBase:WBGene00006737"
                     /translation="MSDSTQMEANAAINEIKKRTRKLDQSLQMRFCADQFFIGNHCTK
                     LASGKSIIISQNSKNRICLRFFMAADPLVGYTGRDFGIAFNQIDHISLKDEQQENPAV
                     LICTLNLSSYTKMCKLQTGLKDVVEKPFLYNKSLARNLTFILKPWNDDPDTFVKISYN
                     DEHREYVHSYDYDVAKSLMFKEVQAVWEQSLKEQLQRRHQTGRVYLTSQLSEMTPREW
                     VQFLADQKLSKIVCHNGSIQYARVEDNPHGRKHTAVATNGFDHRGTRVLNSFGKAHAS
                     LATQEKSYAKKRKLTEQSLKAHGDFTFPQVSFPNTQQGSCLPSTPTAALPPTRPVVEK
                     IPPDTQLFTFPPSGSCTTGMDPVVLLVKDIKTLDRKEFLNDSVMAFMLNYIAFMLSSE
                     LMKSVHMCNTFLFVNLTRLLPPLCFSKRRPIEPEHIKIVKDNCPRVLRWTRKFDVLAK
                     DYIIIPINEDLHWLVIAVINPSGAIVDMSNEEASRAAPKCYIVFFDPLSGLDPSKKNH
                     MCHCIKIYLAQLYENTKAPGMKFASKNPTIYDEERVVVTRAENTPIQDNFYDCGLYVL
                     HFIEGLFCYPNRPVNVNDFPNFDWSKFFPEANKMCDLMRDKVYNLILQQADKPARSRL
                     AKFERENKCGLSREGALRKARRHSAVNERRTKRHRDYYARHYSLSPPHRNVMNDDPTF
                     MNPRGLAEMPITRLVRRLRIPEDNFPIAY"
ORIGIN      
        1 atgagtgatt caactcaaat ggaggccaat gctgctatta atgaaattaa aaaacgaacg
       61 agaaagctag accaatcgct gcaaatgagg ttttgcgctg atcagttttt catcggcaat
      121 cattgcacca aactggcatc cggaaagtca ataattatct cgcagaattc caagaatcgg
      181 atatgccttc gctttttcat ggcagcggat cctttggtgg gctacactgg acgagatttt
      241 ggaatcgctt tcaatcagat agaccacatt tcgctgaaag atgagcaaca agagaatccc
      301 gctgtactca tttgcacttt gaacctctca agctacacaa aaatgtgtaa gctccaaacc
      361 ggcttgaagg atgtcgtcga gaaaccattt ctgtataaca aatctcttgc acggaatttg
      421 acattcatac ttaaaccgtg gaacgatgac cctgacacgt ttgtgaagat ctcatacaat
      481 gatgaacacc gagagtatgt gcacagctat gattacgatg tggccaagtc cttaatgttc
      541 aaagaggtcc aagccgtttg ggaacaatca ctcaaagagc agctacaacg tcgtcaccaa
      601 accggtcgag tttatttgac aagtcaactc agtgaaatga ctcctcgaga atgggttcag
      661 tttcttgctg atcagaagct atctaaaatt gtgtgtcaca acggttctat tcaatatgcg
      721 agagtagaag acaatccaca tggacgaaaa catacagcag ttgccacaaa cggcttcgac
      781 caccgaggaa ccagagtatt gaattcattt ggcaaagcac atgcatctct tgctactcaa
      841 gaaaaatcat atgcaaagaa gaggaaactc acggaacaat ctctcaaggc tcatggtgac
      901 ttcacgtttc cccaagtgtc gtttccaaat acacaacagg gctcatgttt gccgagtact
      961 ccgactgcag cgctgcctcc aactcgacca gttgttgaga aaatacctcc agatacgcaa
     1021 cttttcacgt tcccaccttc tggctcttgc acaacgggaa tggatcctgt agtgttgctc
     1081 gtcaaggata tcaaaacact ggatcgcaaa gaattcctga atgacagcgt catggcattt
     1141 atgctgaatt atattgcatt tatgctttcg tccgagctaa tgaaatccgt gcatatgtgc
     1201 aacacgttct tattcgtcaa tctgactcgc ctacttccac cattgtgctt ctccaaaaga
     1261 cgaccaatcg aaccagaaca cataaaaatc gtgaaagaca attgccctcg agttctccgt
     1321 tggacacgaa aattcgatgt tcttgccaaa gattatatta tcattccgat caacgaagat
     1381 cttcactggc tcgtcatcgc tgttatcaat ccatcgggtg caattgtcga tatgtcgaat
     1441 gaggaagctt ccagagctgc tccgaagtgt tatattgtat tcttcgatcc gttgagtggt
     1501 ctcgatccaa gcaagaagaa tcatatgtgt cactgcatca agatttattt ggctcaattg
     1561 tatgaaaaca ctaaggctcc tggaatgaaa tttgcgtcga agaatccaac gatttacgat
     1621 gaggagagag ttgtcgtgac tcgtgctgaa aacactccaa tccaagacaa cttttatgat
     1681 tgtggacttt atgtattgca tttcattgaa gggctcttct gttatccgaa ccgtccggtc
     1741 aatgtgaacg attttccaaa ctttgactgg tcaaagttct tcccggaggc caataaaatg
     1801 tgtgacttga tgcgagacaa agtttacaat ttgattcttc aacaagcgga taaacctgcg
     1861 agaagccgtc tcgccaagtt cgaaagggag aacaaatgtg gattgtcgcg tgaaggagct
     1921 cttaggaaag cacgtcgtca tagtgcagtg aatgaacgtc gtacgaaacg gcacagagac
     1981 tattatgcac gtcactattc cttgagcccg ccacaccgaa atgtgatgaa cgatgatccg
     2041 acgttcatga atccacgtgg attggcggaa atgccaataa ctcgacttgt tcgtcgcctc
     2101 agaattccgg aggataactt cccaatcgct tactag
//