Dbfetch

LOCUS       NM_001316808            9783 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans KETtiN (Drosophila actin-binding) homolog
            (ketn-1), partial mRNA.
ACCESSION   NM_001316808
VERSION     NM_001316808.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 9783)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 9783)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 9783)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 9783)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..9783
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            <1..>9783
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /db_xref="GeneID:178740"
                     /db_xref="WormBase:WBGene00004130"
     CDS             1..9783
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /standard_name="F54E2.3l"
                     /note="Product from WormBase gene class ketn;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="KETtiN (Drosophila actin-binding) homolog"
                     /protein_id="NP_001303737.1"
                     /db_xref="GeneID:178740"
                     /db_xref="GOA:A0A0M9JJ85"
                     /db_xref="InterPro:IPR003598"
                     /db_xref="InterPro:IPR003599"
                     /db_xref="InterPro:IPR007110"
                     /db_xref="InterPro:IPR010939"
                     /db_xref="InterPro:IPR013098"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR036179"
                     /db_xref="UniProtKB/TrEMBL:A0A0M9JJ85"
                     /db_xref="WormBase:WBGene00004130"
                     /translation="MSSNKYVFGVNYGPKPTVPPNSSSSLSGMSHILKSTESHSRKPA
                     TATRNNGMGLLNLSNSAKDAILGAVQHPRSYARIQEIEAPKPAPQEVPDLPHQPPAFV
                     KQLGPAIQCMEGDNVYLEAQVTPTDDNSLTYEWLVNGQPLMKAHRFVLSQDFGYIALN
                     ILYCYPEDNGTYTLVVRNRAGEAQSTVDINCGHTGGNFTDSFHPNSLHRIAELETPIQ
                     RAEPLPDKEKEVPTIAKPLPATIDSVHESQTLHLEAQVTPIDDNTLRYEWLFNGNPLK
                     ASSRYRVLNDFGFVSLDIDYIIAEDSGKYTLVVYNSAGRAETSCEFQVDRLKSILSDT
                     AHPESLRRIREMEQLQPAKPSDDDAAAQPPVFTQQLTGPTEPLKEGQSVHMDCVVQPI
                     NDPSLRIEWFHDGRPLMFGSRIRTIHDFGYVGLEFLHIHPEDTGTYTCKATNLIGEAT
                     TDIFLECKPRRNIYLDTHHESSWQKIQEIENRVDEREPTPELTFQPPTFTENLADKED
                     AQEGQSIRLECRLIPVNDPTMRVTWTRNGQPLPEASRFMPARNFDYVNLDILALYGED
                     SGVYTCKAVSAFGEAATSCTVKCAAGKSLLLDTMHDASWKRVQEIENREKLEAVDAEP
                     EKTAPKFVTQLNSSLGELQEGVPIHLEAQVEPTNDNQLTVQWFHNGQPLANGHRFRTR
                     HDFGYVALDILYAFAQDTGEWACVARNSLGEAQTIANFTVLPRGTIYTDSQHPESWQK
                     IQVLEAPRAAAPEKPDAEHDAPQFIEPLDSIDRMEFQSAHFQTKVTPQTDPNLRIQWF
                     KDGQPLMNSNRFKLTTDFGYISLDIAHTVPEDSGVYSVKASNAKGDAEVQAQLTVTGN
                     AVILGDTQHEQSWQKIQLIEAPRAPGEEEPDVKHGPPKFVTQLHSLDGVVEGQPSHFE
                     AQFIPFSDPKTSVQWYLNGNPLSASSRRILRNDFGLVSLDLQYTLGEDAGEYSVVVKN
                     SEGEDRTSGQLSCTTRAAILGDTQHEQSWQRIQEIEAPRAPGAEPEGPVYEKPSFVQP
                     LQSVGDLPEGSVALLEARLVPVNDPNLRVQWFYNDQPLMESNWISTSNDFGCVSLRIA
                     PVYARHTGVYSCKAWNDSGNAVTSANVGVQGSEGLLLDTSHPASLQKIQELEAIDKYA
                     RLDAPEREYEKPQWVQGFENYENVGEGQTVTLHGLVEPSGDPHLRLEWLLNGTPLRNA
                     NRFRQEYEFGNAILTIVHVLPHDSGVYTCRAWNTQGEASTSATVTTAGYEKILYDSQH
                     PVSWERIQELEAPKIVEEIEEIVQKEKPNFLTQLESAENVPEGVPLHLESTFQPARDP
                     ELKVVWQKNGQPLGASQLVQTKHELGWATLDISSANEDHNGVYTLTITNSEGEAVSTA
                     SIRVAGTGPILGNTRHEESWKRIQILEAPKEAEPEAPAPVYDHPAITTQIDDKECNEG
                     DHVHFEALITPVNDPRLQVQWIRNGVPLAHGSKYAIQQDFGICTLDVAYTYPEDEGVY
                     QLRIWNPEGEAVSSATLKCHGKDAILGDVQHQESWKRIQEIEAPKQKLEEADPEPKGP
                     PRFIQQLTSPGSLVENQPAHFEATVEPVDDPTLTINWFLNGEPMSASSRVKMINDFGW
                     VIMDIAQTEPRDSGEWKCVAKNAAGEAVSTATIEVQGKEVILQDSLQPQSLDRIRQIE
                     AGKPAPEERPDQQFEAPAIVNALQVQGALEEGGSAHLQTQFTPVADPSIKVEWLKDGQ
                     PIFHSNRYKMVHDFGFAVLDILHLLKHDAGEYTFRVSNNSGEASTSTSFEVSESSGLI
                     LQPQNEQKAKAVEILEDNLRRRPEEIEQELKEATPVFIEPLSAPVETEEGGRAHFTAR
                     YEPVNDNQLQVQWYHDGRPLKNGSRIKTINSFGYVVLEISPTYPEDNGEYICRAVNRV
                     GEAVTSTKLTCTPKEGIISATQLPERMANAGRRIAEIEAPRPAREDAPDADHGPPKFT
                     SALAGPPELQEGQQAHLECQVTPVADPRLVIEWFHNGQPVNHTNRMKAIHDFGFVVLQ
                     LTPAEPQDSGTWTCRATNQHGSDEVSTELKVVGGGGVSYEWQSTAERKERITELEDWI
                     HRPKEDLNLPAVDYPAPSFSQGLTDLGQLNEADATAFVCVLEPIGDPTLRVQWEHNGH
                     PIPYSNRISCTNEFGVATLLIKHLIAADAGEYKCVATNVKGSATSVGKIAVESSTQID
                     APQVVQQLVDSVENILEGDSIHLECRVTPINDPRLHVEWLRNGAPLPEASRFKPTFEF
                     GFVSLDILYAYPEDNGDYELVVRNDKGEARSKTKITVLPRPSLDYTSQTHGNQQDSLE
                     SHFKQHSQAKLQLTANDIYNESDKRAPEFRTQLQNIGVLEGEFCRFETQVAPINDPYL
                     KVEWFKDKKPVLLGHRFRSTLDFGFACLDLLYALPDDTGEYHCVATNRHGQTMISAKL
                     ACQGASHVITDSQMPQGLRVSNVKKDNKNIYWSEQGGAVQPKQKQAPQFTIPLRNLQV
                     TENQPARFECAVTGYPRPKVTWFINGNQCLHGHRFKLNFDGLHYLTVSKSRISDAGEV
                     VAIARNTEGETISTATLDIFQNDDFRQTKLRPANFKTSDELRERELQWQRDTLGSLGP
                     AFEAAPKPDAQKLMHVERAQSPIEPMESQELIQKFTRPRDDNFYNKLSYVELQKPQFK
                     GMELEEVNLKAGKVEKYQPPVEEMERVNLKAIPEKDQQEVGWERPDWAGQDGTSKLPG
                     ADEGRFKKLPTPAPELDVPARDQVKLKTAKPTRGKDLEAGEKVKLKTEKAKIKEIQQK
                     PEQPKEEPIVHKDAVQLKTQQLPKTGIKGDHFTVDREKDLKETPAVVKPVIEETRISN
                     KPQPTKIGQSKQAPPTISQQLKPLQGELGKAAKFVIEFAGAAPVKVTWLKDGKEIKST
                     FRTLITTTPTNSSLHIGRLENSHAGEYTVRLENAAGTVESLANLTVAPPTTQGKAPDF
                     SARLNDLRIQQNGPAEFSCQIGGEPKPTIQWFKDGQPLPNDDRFQVVEEGGAYKLKFS
                     NIISTDAGIYEIVAKNGVGEARCKARLNVNLQKTGKGAEEGPRYEAPRFTSQIQPIVV
                     DEGKGAQFSAQFSGFPDPTIRWYRNNEPVKHADGYEISQSKGEAILRISAARNEDVAE
                     YKVEASNPAGKASSVANLVLTPRSGRIAKSTISRGGSASYQSSDKAAADSPHFIAKLS
                     DISARQGHTVKFSAEVDGNPEPTVQWQFKGKPISASNNVKISRDGKRAILELARVTPD
                     SAGEYQIVIRNDKGAATSQAKLTLSR"
     STS             1339..2521
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /standard_name="F54E2.3"
                     /db_xref="UniSTS:311783"
     STS             4286..5198
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /standard_name="R05D8.n"
                     /db_xref="UniSTS:322613"
     STS             5650..7340
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /standard_name="R05D8.m"
                     /db_xref="UniSTS:323579"
ORIGIN      
        1 atgagcagca acaaatatgt gttcggtgtt aattatggtc ccaaaccgac ggtcccccca
       61 aatagctcgt ctagtttaag cggaatgagt catattctga aatcaaccga gagtcattca
      121 agaaaaccgg cgactgccac tagaaataac ggaatggggt tattaaatct ttcaaattca
      181 gcaaaagatg ccatcctcgg agcagttcaa cacccaagaa gctatgctag aattcaggag
      241 attgaggcgc cgaaaccagc gccacaagag gttccagatc ttccacatca gccaccagca
      301 ttcgtgaagc agttgggacc agctattcag tgtatggagg gagacaatgt gtacctagag
      361 gctcaagtga cacccactga tgataattcg ctaacttacg aatggctcgt caatggtcag
      421 ccactcatga aggcccatcg ttttgtattg tctcaagact ttgggtacat tgcgctgaac
      481 attctctact gttatccgga agataatggt acgtacacac tagttgtgcg aaaccgagca
      541 ggagaagctc aatcgacggt cgacatcaac tgtgggcata ctggaggaaa tttcaccgac
      601 tcattccatc caaactctct ccatcgtatt gccgagctcg agactcctat tcaacgagcc
      661 gagccacttc cagacaagga aaaggaagta ccaacgattg ccaagccact tccagcgact
      721 atcgactcgg tccacgagtc acagactctt catttggagg ctcaagtcac cccgattgac
      781 gataatactc tgagatacga atggttgttc aacgggaacc cactgaaggc atccagcaga
      841 tatcgtgttc tcaatgactt tggatttgtg tccctcgaca ttgactacat cattgccgag
      901 gacagtggaa agtacacctt ggtcgtttac aactctgccg gacgtgctga gacctcttgc
      961 gaattccaag tcgatcgcct gaagtcgatt ctctccgaca ccgctcatcc ggaatctctt
     1021 cgtcgtattc gtgagatgga gcaacttcaa ccagctaagc catcggatga tgatgcagct
     1081 gctcagccac cggtgttcac tcaacaactc accggaccaa ctgagccact caaggaagga
     1141 caatcggttc atatggactg cgttgttcag ccgatcaatg atcctagtct gagaatcgag
     1201 tggttccacg acggaagacc attgatgttc ggatcgcgta tccgtactat tcacgacttt
     1261 ggatatgtcg gtcttgagtt ccttcacatc cacccagagg atactggaac ttacacttgc
     1321 aaggctacca atcttattgg tgaagctacc accgacatct tcttggagtg caagccacgt
     1381 cgcaacatct atcttgacac tcaccacgag tcttcgtggc agaagattca agaaatcgag
     1441 aaccgtgtgg atgagcgtga accaacgccg gaacttacat tccagccacc aacgttcact
     1501 gagaacctgg ctgacaagga agatgctcaa gaaggacaat cgattcgtct cgagtgccgc
     1561 ttgattccag ttaacgatcc aacaatgaga gtcacttgga caagaaatgg tcagccactt
     1621 ccagaagctt caagattcat gccagcaaga aactttgatt atgtcaactt ggacattctt
     1681 gcgttgtacg gagaagactc aggtgtctac acttgcaaag ctgtttcagc attcggagaa
     1741 gctgccacct catgcacagt caagtgtgcc gcaggaaaat cacttcttct tgataccatg
     1801 catgatgctt cctggaagcg tgttcaagaa attgaaaacc gtgagaagct agaggcagtg
     1861 gatgctgagc cagaaaagac tgcaccaaag ttcgtcactc agctcaattc ctcccttgga
     1921 gagcttcaag aaggagttcc aattcatttg gaagcacaag tggagccaac aaacgacaat
     1981 cagctcacag tacaatggtt ccacaatgga caaccacttg ccaatggaca tcgtttccgt
     2041 actcgtcacg atttcggata tgtcgctctt gacatcttgt acgcatttgc gcaggatact
     2101 ggagaatggg catgtgttgc cagaaactcc ctcggagagg cacagaccat cgcaaacttc
     2161 acagttttgc cacgtggaac tatctacacc gattctcaac acccagaaag ttggcagaag
     2221 attcaagtac ttgaagcacc acgagctgca gcaccggaga agcctgatgc tgagcatgat
     2281 gctccacaat ttattgagcc actcgacagt atcgatagaa tggaattcca atcagctcac
     2341 ttccagacca aggtcactcc acaaacggat ccaaacctta gaatccaatg gttcaaggat
     2401 ggtcagccat tgatgaactc taaccgattc aagttgacta ccgacttcgg atacatctca
     2461 ctggacattg ctcacactgt tccagaagac agcggtgtct attcagtcaa ggcaagcaat
     2521 gccaagggag acgctgaagt tcaagctcag ctcactgtaa ctggaaacgc tgttatcctt
     2581 ggagacactc aacacgaaca atcatggcag aagattcagc tcatcgaagc tccaagagcc
     2641 cctggagagg aggagcctga tgtcaagcac ggaccaccaa agtttgtcac ccaattgcat
     2701 agccttgatg gagtggttga aggacagcca tctcactttg aagcccagtt cattccgttc
     2761 tcggatccaa aaacatctgt tcaatggtat ctcaacggaa atccactctc tgcgtcttct
     2821 cgcagaatcc tacgcaacga ttttggactt gtctccttgg atcttcaata cacacttgga
     2881 gaagatgctg gagaatatag cgtcgttgtc aagaactctg aaggtgaaga tagaacatct
     2941 ggacagctgt cgtgtaccac tagggccgcg attcttggag acactcaaca cgagcaatcg
     3001 tggcagagaa ttcaagagat cgaagctcca agagctccag gcgccgagcc ggaaggaccg
     3061 gtctatgaga agccatcctt cgttcaaccg cttcagtccg tcggagatct gcctgaagga
     3121 tctgttgctc ttctcgaggc tcgtcttgtc ccagtcaatg atccaaatct tcgagttcaa
     3181 tggttctata acgatcagcc attgatggag tctaactgga tctcaaccag caacgacttt
     3241 ggatgtgtct cgttgagaat tgctccagtg tacgccagac ataccggagt atactcttgc
     3301 aaggcctgga acgacagtgg aaacgctgtc acatctgcga atgttggagt tcaaggatca
     3361 gaaggccttc ttctggatac ttctcatcca gcgtctcttc agaagattca agagctcgag
     3421 gctatcgaca agtacgcaag acttgatgca cctgaaagag aatacgagaa acctcaatgg
     3481 gttcaaggat tcgaaaacta cgaaaatgtt ggagaaggac aaactgtcac tcttcatgga
     3541 ctcgtcgaac catctggaga tccacatctt cgtctcgaat ggctccttaa cggaactcca
     3601 cttcgaaatg caaaccgttt ccgtcaagag tatgagttcg gaaacgcaat cctcaccatc
     3661 gttcacgtcc tcccacacga ctctggtgtt tacacctgcc gtgcctggaa tactcaagga
     3721 gaagcttcaa catctgcgac cgtgactact gctggctacg agaagatttt gtacgactcg
     3781 cagcacccag tttcatggga gcgtattcaa gagcttgagg ctccgaagat cgtcgaggaa
     3841 attgaggaaa ttgttcaaaa ggagaaacca aacttcctta ctcaactgga gtcggctgaa
     3901 aatgttccag aaggagtccc acttcacctg gaatctacat tccagccagc tagagaccca
     3961 gaacttaagg ttgtttggca gaagaacggc cagccactcg gagcttcaca gttggtgcag
     4021 actaaacatg aacttggatg ggctacactg gacatttcct cagcaaatga agatcacaat
     4081 ggagtgtaca ctcttacaat taccaacagc gaaggagagg ctgtgtcgac cgcttcaatc
     4141 cgggtagccg gaactggacc gattcttgga aacactcgtc atgaagaatc atggaaacgc
     4201 atccagattc tggaagctcc aaaggaagct gaaccggaag cgccagctcc agtatatgac
     4261 catccagcaa tcaccacgca gattgatgat aaggagtgca atgaaggaga ccacgttcac
     4321 tttgaggcac tcatcactcc agtcaacgat ccaagacttc aagttcaatg gattcgaaac
     4381 ggagttccac ttgctcatgg atcaaagtac gccattcaac aagactttgg aatctgcact
     4441 ctcgatgttg cctacactta tccggaagac gaaggtgtct atcaacttcg tatctggaat
     4501 ccagaaggag aagctgtgtc atctgccacg ctcaagtgtc atggaaagga tgcaattctc
     4561 ggagacgtgc aacatcaaga aagctggaag cgtattcaag aaatcgaggc gccaaagcaa
     4621 aagcttgagg aagccgatcc ggagccaaag ggtccaccac ggttcatcca acagctcacc
     4681 agcccgggaa gtctcgtgga aaaccaacca gctcactttg aagctactgt cgaaccagtc
     4741 gatgatccaa ctcttacgat caactggttc cttaatggag agccaatgtc tgcgtcgtct
     4801 cgtgttaaga tgatcaatga ttttggatgg gtgatcatgg atattgctca aaccgaacca
     4861 agagattctg gagaatggaa atgtgttgct aagaacgcag ctggagaagc tgtctcaaca
     4921 gcaacgattg aagttcaagg aaaggaagtt atccttcaag actctctcca gccacaatca
     4981 cttgatcgta ttcgccagat tgaagctgga aaacctgctc cagaagagcg cccagatcaa
     5041 cagtttgagg ctccagctat cgtcaacgct cttcaagtcc agggagcgtt ggaagaggga
     5101 ggaagtgctc atcttcaaac ccaattcact ccagtggctg atccctcgat caaggtggaa
     5161 tggctcaagg atggtcaacc gatcttccac tcaaatagat acaagatggt tcacgacttc
     5221 ggattcgctg ttttggacat tttgcatcta ctgaaacacg atgctggaga gtatactttc
     5281 cgagtttcga acaactcggg agaagcatct acttctacaa gtttcgaagt ttccgagagc
     5341 tctggtctta ttcttcagcc acagaatgaa cagaaggcga aggccgtcga aattctcgag
     5401 gataacttaa gaagacgccc tgaagaaatc gagcaagagc ttaaggaggc tacaccagtc
     5461 ttcattgagc cactctcggc tccagttgaa actgaggagg gcggacgtgc tcatttcacg
     5521 gctcgttacg agccagtcaa tgacaatcag cttcaggttc aatggtacca tgatggtcgc
     5581 ccattgaaga atggaagtcg tatcaagact atcaacagtt ttgggtacgt cgttcttgag
     5641 atcagcccaa catatccaga agacaacgga gagtacattt gtcgtgctgt gaaccgtgtt
     5701 ggagaggcag tcacctcgac aaagcttacc tgcacaccta aagaaggaat catcagtgcc
     5761 actcaacttc cagaacgcat ggcaaacgcg ggaagacgaa ttgccgagat tgaagcacca
     5821 agaccagctc gtgaagatgc tccagacgct gatcatggac caccaaagtt cacgtcggca
     5881 cttgcaggac caccagagtt gcaagaagga caacaggctc acttggagtg ccaagtcact
     5941 ccagttgctg atccaagact ggtgatcgag tggttccaca atgggcaacc agtgaatcac
     6001 actaacagaa tgaaggctat ccatgatttc ggtttcgtgg ttcttcaact gacaccagcc
     6061 gaaccacaag actctggaac ctggacttgc cgtgccacca atcaacatgg atctgatgaa
     6121 gtatccacag agctcaaggt cgtcggcggt ggcggtgtct catacgaatg gcagagcact
     6181 gcagagcgca aggagcgcat cacagagctc gaggactgga ttcatagacc gaaggaggat
     6241 ctcaatcttc cagccgtcga ctatccagca ccatccttct ctcaaggtct caccgatctt
     6301 ggacagctca acgaggccga tgctacagcg tttgtgtgtg ttttggagcc aattggagat
     6361 ccaactctcc gagttcaatg ggagcataat ggacatccga tcccatactc caatcgtata
     6421 tcttgcacaa atgaatttgg agttgccact cttctcatca agcatctcat tgccgccgat
     6481 gctggagagt acaagtgtgt tgccactaac gtcaaggggt ccgctacatc tgtcggaaag
     6541 attgccgtcg agtcatccac tcaaattgat gctccacaag tcgttcaaca actcgttgac
     6601 agtgttgaaa acattttgga aggagattca atccacctcg aatgtcgtgt cactccaatc
     6661 aacgacccac gtcttcatgt ggaatggctc agaaatggag caccacttcc agaagccagt
     6721 agattcaagc caacgttcga gtttggcttt gtcagcctgg atattcttta tgcttaccca
     6781 gaagacaatg gagattacga acttgtcgtc cgtaacgaca agggtgaggc tcgttccaag
     6841 acgaagatca cagttcttcc aagaccatct ttggactaca cttctcaaac tcatggaaac
     6901 caacaagatt ccctggaatc tcacttcaaa caacattctc aagctaaact tcagctcacc
     6961 gccaatgaca tctacaacga gagtgacaag cgcgctccag agtttcgtac tcaacttcag
     7021 aacatcggag tcttggaagg agagttctgc cgcttcgaga cccaagtcgc accaatcaac
     7081 gatccatacc tcaaagttga atggttcaag gacaagaagc cagttcttct tggacatcgt
     7141 ttccgatcaa ctctcgactt tggattcgct tgcctcgatc ttctgtatgc tcttccagat
     7201 gacactggag aatatcactg cgtcgccaca aaccggcatg gtcaaactat gatcagcgct
     7261 aagttggcgt gccagggagc ttctcatgtg atcaccgata gccagatgcc acagggcttg
     7321 agagtcagca atgtgaagaa ggacaacaag aacatctact ggagtgaaca aggaggagct
     7381 gtgcagccaa aacaaaagca ggcaccacag ttcactattc cactccgaaa ccttcaagtc
     7441 acagagaatc agccagctcg ctttgaatgc gctgtaactg gatatccaag accaaaggtc
     7501 acctggttca tcaatggaaa ccaatgtctc catggacacc gcttcaagct caacttcgac
     7561 ggtcttcact atcttaccgt cagcaagtcc agaatctcag acgctggaga agttgttgcg
     7621 attgctagaa acaccgaagg agaaacaatt tctactgcta ccctcgacat cttccaaaac
     7681 gatgacttca gacagaccaa gttgagaccg gctaacttca agacatccga tgagttgaga
     7741 gaaagagagt tgcagtggca acgtgatact ttgggatctc ttggcccagc gtttgaggct
     7801 gctccaaaac cagatgctca aaaacttatg cacgtggaaa gagcccaaag cccgatcgaa
     7861 ccaatggagt cccaggagct tattcagaag ttcacacgcc cacgcgacga caacttctac
     7921 aataagcttt cttacgtcga gcttcagaag ccacaattca agggaatgga gctcgaggaa
     7981 gtcaatttga aagctggtaa agttgagaag tatcaaccac cagttgaaga aatggaacga
     8041 gtcaatctca aggccatccc agaaaaagat caacaagagg tcggatggga aagacccgac
     8101 tgggccggac aggatggtac gtcgaagttg ccaggagccg atgaaggtcg cttcaagaaa
     8161 cttccaactc cagcgccaga gctcgacgtt ccagccagag atcaagttaa gcttaagacc
     8221 gcaaagccaa cacgtggaaa ggacttggag gccggtgaga aggtgaagct gaagactgaa
     8281 aaggcaaaga tcaaggagat tcaacaaaag ccagaacagc caaaggaaga gccaattgtt
     8341 cacaaggatg cggttcagct taagactcaa caacttccaa agactggcat caagggagat
     8401 cacttcaccg ttgacagaga aaaagatctg aaggagactc cagcagtggt aaagcctgtt
     8461 attgaggaga caagaatcag caacaagcca caaccaacaa agatcgggca atctaagcaa
     8521 gctccaccga caatctccca gcagttgaaa ccactgcaag gagaacttgg aaaagccgcc
     8581 aagtttgtta tcgaatttgc cggtgccgct ccagtcaagg tcacttggct taaggacgga
     8641 aaggagatta agagcacttt cagaactttg atcactacca ctccaacaaa ctccagcctt
     8701 cacatcggtc gccttgaaaa ctcccacgcc ggagaataca cagtacgact ggagaacgcc
     8761 gctggaaccg ttgaatctct agccaatctt actgtcgctc caccaaccac acaaggaaag
     8821 gctccagact tctcggcgcg tctcaacgat ctcagaatcc aacagaatgg tccagctgag
     8881 ttctcctgcc aaatcggagg agaaccaaag ccaacaatcc aatggttcaa ggatggacaa
     8941 cctcttccaa atgacgatcg attccaagtt gtcgaggaag gaggcgccta caagctcaag
     9001 ttctcgaaca tcatctctac cgatgccgga atctacgaga ttgttgctaa gaacggagtc
     9061 ggagaggctc gctgcaaggc tcgcctcaac gtaaacctcc agaagaccgg aaagggtgcc
     9121 gaagaaggac cacggtacga agcgccaaga ttcacatccc agattcaacc catcgttgtc
     9181 gatgaaggaa agggtgctca gtttagtgca cagttctccg gattccctga tccgacgatc
     9241 cgatggtata gaaacaatga gcccgtgaaa cacgccgacg gatatgagat ttcccaatcg
     9301 aagggagaag ccatcctgag gatatctgca gcgagaaatg aagatgttgc agagtacaag
     9361 gttgaagcta gcaatccagc cggaaaggct tcatcggttg ccaacttggt tttgactcca
     9421 cgatccggaa gaatcgccaa gtcgacgatt tcccgtggtg gatctgcatc atatcaatcg
     9481 tccgacaagg ccgccgccga ctctccacat tttatcgcaa aactttccga catctctgcc
     9541 cgacaaggac acactgtcaa attcagcgcc gaggtggacg gaaatccgga gccaactgtt
     9601 cagtggcaat tcaagggaaa accaatttct gcgtctaaca acgtaaagat ctcacgtgac
     9661 ggcaagcgtg ccattctcga gctggctcga gtcacgcccg acagcgccgg agagtaccag
     9721 atcgtcatca gaaacgacaa gggagctgcc acgtcacaag ccaagctcac actcagtcgc
     9781 tag
//