Dbfetch

LOCUS       NM_001312970            1164 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Prion-like-(Q/N-rich)-domain-bearing protein
            (pqn-80), partial mRNA.
ACCESSION   NM_001312970
VERSION     NM_001312970.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1164)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1164)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1164)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1164)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1164
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>1164
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /db_xref="GeneID:176683"
                     /db_xref="WormBase:WBGene00004161"
     CDS             1..1164
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /standard_name="Y111B2A.14o"
                     /note="Product from WormBase gene class pqn;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Prion-like-(Q/N-rich)-domain-bearing protein"
                     /protein_id="NP_001299899.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004161"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14o.1"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14o.2"
                     /db_xref="GeneID:176683"
                     /db_xref="UniProtKB/TrEMBL:A0A0K3AU76"
                     /db_xref="WormBase:WBGene00004161"
                     /translation="MMRAQQLQRRQEEAPPPQQAPAPHTQKIQVKNEPVDHSFDILKE
                     AEKDAHIIPTKSIKAEPLDVQKPLSAFEKLASLRGRTQSADMRRGGDSTEMPNVTQQY
                     QAEQNHLAQSSNNSQYNAPSTSSQPQHFPTEPSIRQPPPQQSYNSNQMLQNPRQQPQN
                     QIVQNFQSAPQRHPHQNPQIATSSSSGGVNQFYNNGGAAPPVVEQQAANRRSSFTMSH
                     SVQQHQSPLQQQFPINSYQSPSHHNNSSSMSNSSLMQTPHSNSSMIARSPQFPSHTSP
                     MSQRFHTPPSVGHQMVQSPLSQPNPSPLQHFNFSPHSSSFSSQRPQMPPQRQMSQQNL
                     MHQQQQPQNHTQHQYQHQTFSSQQQQLQQHQHQIRHQMNTNYPPPPGYNHHGH"
ORIGIN      
        1 atgatgaggg ctcaacagct gcaaagacgg caggaagagg ctccgccccc tcaacaagct
       61 ccagctccac atacacaaaa gattcaagtg aaaaatgagc cagtagatca ttcattcgat
      121 attctaaaag aagcagaaaa agatgcacac ataattccaa caaaatcaat aaaagccgag
      181 ccgctggacg ttcaaaaacc gcttagcgca tttgaaaagc ttgcatcact tcgtggtagg
      241 acccaatctg ctgatatgag aagaggcggg gactctacgg aaatgccgaa tgtgacacaa
      301 caatatcaag cggagcaaaa tcatctagca caaagttcga ataattctca gtacaatgca
      361 ccaagtacaa gttcccagcc acaacatttc ccaacagagc cttcaatacg ccaaccacct
      421 ccccaacaga gttacaattc caaccaaatg ctccaaaatc cacgacagca accccaaaac
      481 caaattgtgc aaaatttcca aagtgctccg caacgacatc cccatcaaaa tccgcaaatt
      541 gccacgtcat cttcatctgg aggagtcaat cagttttata ataatggtgg agctgcaccg
      601 ccagttgtcg aacaacaagc cgctaataga agatcatcat tcacaatgtc tcattcagtt
      661 caacaacacc aatctcctct ccaacaacaa tttccaatca attcatatca atcaccgagt
      721 catcataata atagtagctc aatgagcaat tcctcattaa tgcaaacacc acacagtaat
      781 agttcaatga ttgcacggag tccacaattt ccatctcata cgtccccaat gtcccaacga
      841 ttccataccc caccatcagt tgggcatcaa atggtgcaga gcccattgtc tcaaccgaat
      901 ccttcgcctc ttcaacattt caacttttcg ccacattcct ccagtttttc atcacaaaga
      961 cctcaaatgc cgccacaacg tcaaatgagc caacaaaatc tcatgcatca acagcaacaa
     1021 ccacaaaatc atactcaaca tcagtaccaa catcagacat tcagttctca gcaacaacag
     1081 cttcaacaac atcaacacca aatccggcac caaatgaata ccaactaccc accgccacca
     1141 ggctacaatc atcatggcca ttaa
//