Dbfetch

LOCUS       NM_001312969            1683 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Prion-like-(Q/N-rich)-domain-bearing protein
            (pqn-80), partial mRNA.
ACCESSION   NM_001312969
VERSION     NM_001312969.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1683)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1683)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1683)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1683)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1683
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>1683
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /db_xref="GeneID:176683"
                     /db_xref="WormBase:WBGene00004161"
     CDS             1..1683
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /standard_name="Y111B2A.14n"
                     /note="Product from WormBase gene class pqn;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Prion-like-(Q/N-rich)-domain-bearing protein"
                     /protein_id="NP_001299898.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004161"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14n.1"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14n.2"
                     /db_xref="GeneID:176683"
                     /db_xref="UniProtKB/TrEMBL:A0A0K3ARX0"
                     /db_xref="WormBase:WBGene00004161"
                     /translation="MAQTLATQKTQNKQCLTQNDYQLLFDYFGKFEKALEQRKAKKEE
                     AERLKKLEEKLKKEKEKQAEKDRIEAKKFEERMKKEQEKQEEKERKEREKREEKERKE
                     REIREIMERKKREEDDRIAAKLQIAQQLENDRKMREAEESARKETERRAKMETERKVA
                     EARRAVERENQIKMMRAQQLQRRQEEAPPPQQAPAPHTQKIQVKNEPVDHSFDILKEA
                     EKDAHIIPTKSIKAEPLDVQKPLSAFEKLASLRGRTQSADMRRGGDSTEMPNVTQQYQ
                     AEQNHLAQSSNNSQYNAPSTSSQPQHFPTEPSIRQPPPQQSYNSNQMLQNPRQQPQNQ
                     IVQNFQSAPQRHPHQNPQIATSSSSGGVNQFYNNGGAAPPVVEQQAANRRSSFTMSHS
                     VQQHQSPLQQQFPINSYQSPSHHNNSSSMSNSSLMQTPHSNSSMIARSPQFPSHTSPM
                     SQRFHTPPSVGHQMVQSPLSQPNPSPLQHFNFSPHSSSFSSQRPQMPPQRQMSQQNLM
                     HQQQQPQNHTQHQYQHQTFSSQQQQLQQHQHQIRHQMNTNYPPPPGYNHHGH"
ORIGIN      
        1 atggctcaga cattggcaac acaaaaaact caaaataagc agtgcctgac ccaaaatgac
       61 tatcaactac tttttgatta ttttggaaag tttgaaaaag cattagaaca acgaaaagca
      121 aaaaaagaag aagctgaaag attgaagaaa ttggaggaaa aattgaaaaa agagaaggag
      181 aaacaagcag agaaagatag aattgaggcg aagaaattcg aagagcggat gaaaaaagag
      241 caagaaaaac aggaagaaaa agagagaaaa gaacgggaaa aacgagagga aaaggaaagg
      301 aaagagagag aaattcgaga aattatggag aggaaaaaga gagaagaaga cgatcgaatt
      361 gctgcgaaat tacaaattgc tcaacaatta gagaatgaca ggaaaatgag agaagctgaa
      421 gaaagtgcac ggaaggagac ggaacggagg gctaaaatgg aaactgaacg aaaagtggcg
      481 gaagctcggc gagcagttga acgtgagaat cagatcaaaa tgatgagggc tcaacagctg
      541 caaagacggc aggaagaggc tccgccccct caacaagctc cagctccaca tacacaaaag
      601 attcaagtga aaaatgagcc agtagatcat tcattcgata ttctaaaaga agcagaaaaa
      661 gatgcacaca taattccaac aaaatcaata aaagccgagc cgctggacgt tcaaaaaccg
      721 cttagcgcat ttgaaaagct tgcatcactt cgtggtagga cccaatctgc tgatatgaga
      781 agaggcgggg actctacgga aatgccgaat gtgacacaac aatatcaagc ggagcaaaat
      841 catctagcac aaagttcgaa taattctcag tacaatgcac caagtacaag ttcccagcca
      901 caacatttcc caacagagcc ttcaatacgc caaccacctc cccaacagag ttacaattcc
      961 aaccaaatgc tccaaaatcc acgacagcaa ccccaaaacc aaattgtgca aaatttccaa
     1021 agtgctccgc aacgacatcc ccatcaaaat ccgcaaattg ccacgtcatc ttcatctgga
     1081 ggagtcaatc agttttataa taatggtgga gctgcaccgc cagttgtcga acaacaagcc
     1141 gctaatagaa gatcatcatt cacaatgtct cattcagttc aacaacacca atctcctctc
     1201 caacaacaat ttccaatcaa ttcatatcaa tcaccgagtc atcataataa tagtagctca
     1261 atgagcaatt cctcattaat gcaaacacca cacagtaata gttcaatgat tgcacggagt
     1321 ccacaatttc catctcatac gtccccaatg tcccaacgat tccatacccc accatcagtt
     1381 gggcatcaaa tggtgcagag cccattgtct caaccgaatc cttcgcctct tcaacatttc
     1441 aacttttcgc cacattcctc cagtttttca tcacaaagac ctcaaatgcc gccacaacgt
     1501 caaatgagcc aacaaaatct catgcatcaa cagcaacaac cacaaaatca tactcaacat
     1561 cagtaccaac atcagacatt cagttctcag caacaacagc ttcaacaaca tcaacaccaa
     1621 atccggcacc aaatgaatac caactaccca ccgccaccag gctacaatca tcatggccat
     1681 taa
//