Dbfetch

LOCUS       NM_001312968            1773 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Prion-like-(Q/N-rich)-domain-bearing protein
            (pqn-80), partial mRNA.
ACCESSION   NM_001312968
VERSION     NM_001312968.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1773)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1773)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1773)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1773)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1773
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>1773
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /db_xref="GeneID:176683"
                     /db_xref="WormBase:WBGene00004161"
     CDS             1..1773
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /standard_name="Y111B2A.14m"
                     /note="Product from WormBase gene class pqn;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Prion-like-(Q/N-rich)-domain-bearing protein"
                     /protein_id="NP_001299897.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004161"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14m.1"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14m.2"
                     /db_xref="GeneID:176683"
                     /db_xref="UniProtKB/TrEMBL:A0A0K3AX82"
                     /db_xref="WormBase:WBGene00004161"
                     /translation="MAQTLATQKTQNKQCLTQNDYQLLFDYFGKFEKALEQRKAKKEE
                     AERLKKLEEKLKKEKEKQAEKDRIEAKKFEERMKKEQEKQEEKERKEREKREEKERKE
                     REIREIMERKKREEDDRIAAKLQIAQQLENDRKMREAEESARKETERRAKMETEAANA
                     LQGLEEDLLMDDIDFMTQQQTKVDEERKVAEARRAVERENQIKMMRAQQLQRRQEEAP
                     PPQQAPAPHTQKIQVKNEPVDHSFDILKEAEKDAHIIPTKSIKAEPLDVQKPLSAFEK
                     LASLRGRTQSADMRRGGDSTEMPNVTQQYQAEQNHLAQSSNNSQYNAPSTSSQPQHFP
                     TEPSIRQPPPQQSYNSNQMLQNPRQQPQNQIVQNFQSAPQRHPHQNPQIATSSSSGGV
                     NQFYNNGGAAPPVVEQQAANRRSSFTMSHSVQQHQSPLQQQFPINSYQSPSHHNNSSS
                     MSNSSLMQTPHSNSSMIARSPQFPSHTSPMSQRFHTPPSVGHQMVQSPLSQPNPSPLQ
                     HFNFSPHSSSFSSQRPQMPPQRQMSQQNLMHQQQQPQNHTQHQYQHQTFSSQQQQLQQ
                     HQHQIRHQMNTNYPPPPGYNHHGH"
ORIGIN      
        1 atggctcaga cattggcaac acaaaaaact caaaataagc agtgcctgac ccaaaatgac
       61 tatcaactac tttttgatta ttttggaaag tttgaaaaag cattagaaca acgaaaagca
      121 aaaaaagaag aagctgaaag attgaagaaa ttggaggaaa aattgaaaaa agagaaggag
      181 aaacaagcag agaaagatag aattgaggcg aagaaattcg aagagcggat gaaaaaagag
      241 caagaaaaac aggaagaaaa agagagaaaa gaacgggaaa aacgagagga aaaggaaagg
      301 aaagagagag aaattcgaga aattatggag aggaaaaaga gagaagaaga cgatcgaatt
      361 gctgcgaaat tacaaattgc tcaacaatta gagaatgaca ggaaaatgag agaagctgaa
      421 gaaagtgcac ggaaggagac ggaacggagg gctaaaatgg aaactgaagc agcaaatgca
      481 ctacaaggac tcgaagagga ccttctcatg gatgatatcg attttatgac tcaacaacaa
      541 acaaaagtcg atgaggaacg aaaagtggcg gaagctcggc gagcagttga acgtgagaat
      601 cagatcaaaa tgatgagggc tcaacagctg caaagacggc aggaagaggc tccgccccct
      661 caacaagctc cagctccaca tacacaaaag attcaagtga aaaatgagcc agtagatcat
      721 tcattcgata ttctaaaaga agcagaaaaa gatgcacaca taattccaac aaaatcaata
      781 aaagccgagc cgctggacgt tcaaaaaccg cttagcgcat ttgaaaagct tgcatcactt
      841 cgtggtagga cccaatctgc tgatatgaga agaggcgggg actctacgga aatgccgaat
      901 gtgacacaac aatatcaagc ggagcaaaat catctagcac aaagttcgaa taattctcag
      961 tacaatgcac caagtacaag ttcccagcca caacatttcc caacagagcc ttcaatacgc
     1021 caaccacctc cccaacagag ttacaattcc aaccaaatgc tccaaaatcc acgacagcaa
     1081 ccccaaaacc aaattgtgca aaatttccaa agtgctccgc aacgacatcc ccatcaaaat
     1141 ccgcaaattg ccacgtcatc ttcatctgga ggagtcaatc agttttataa taatggtgga
     1201 gctgcaccgc cagttgtcga acaacaagcc gctaatagaa gatcatcatt cacaatgtct
     1261 cattcagttc aacaacacca atctcctctc caacaacaat ttccaatcaa ttcatatcaa
     1321 tcaccgagtc atcataataa tagtagctca atgagcaatt cctcattaat gcaaacacca
     1381 cacagtaata gttcaatgat tgcacggagt ccacaatttc catctcatac gtccccaatg
     1441 tcccaacgat tccatacccc accatcagtt gggcatcaaa tggtgcagag cccattgtct
     1501 caaccgaatc cttcgcctct tcaacatttc aacttttcgc cacattcctc cagtttttca
     1561 tcacaaagac ctcaaatgcc gccacaacgt caaatgagcc aacaaaatct catgcatcaa
     1621 cagcaacaac cacaaaatca tactcaacat cagtaccaac atcagacatt cagttctcag
     1681 caacaacagc ttcaacaaca tcaacaccaa atccggcacc aaatgaatac caactaccca
     1741 ccgccaccag gctacaatca tcatggccat taa
//