Dbfetch

LOCUS       NM_001312967            3102 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Prion-like-(Q/N-rich)-domain-bearing protein
            (pqn-80), partial mRNA.
ACCESSION   NM_001312967
VERSION     NM_001312967.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3102)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3102)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3102)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3102)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3102
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>3102
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /db_xref="GeneID:176683"
                     /db_xref="WormBase:WBGene00004161"
     CDS             1..3102
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /standard_name="Y111B2A.14l"
                     /note="Product from WormBase gene class pqn;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Prion-like-(Q/N-rich)-domain-bearing protein"
                     /protein_id="NP_001299896.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004161"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14l.1"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14l.2"
                     /db_xref="GeneID:176683"
                     /db_xref="UniProtKB/TrEMBL:A0A0K3AUX0"
                     /db_xref="WormBase:WBGene00004161"
                     /translation="MKHHKTEKVNMEPLIYSLAKSFGMTTQEVMKQVEQEISSKKATT
                     PKPSTNAVLSTISSQKSLEKNAADWKLTQTDLPTMGEKDIQMLTTIVRSWKSKKEISN
                     SMVTGWLKDVNQLKMNADQARKKFFDIINTLPDSSEKNGGGGQQDANDIPKHERSRKA
                     RMFLHQWVYLSRKFLELQLPKLKHHSPPVEGLAKKQVIAANAIKEGVRKQISLFENKK
                     DRLPGDPVYVFQFTEPVLTAVAPYLEDLVDYALAAKKIELIVSGIDALHQSTDGKITI
                     IQFYIEICRRLQKLSFLAVEEPMKSRLKEANEQIMKHQVVQIPKYQLKWPDGQAEPSL
                     KGLNRELYEFDKSILSMVAAKPSAPATPKASSSTALRPSTSSTPSQQQSTSTAKAMTS
                     SSTSAEDAKRLLAMNQLVQVYAGKYLLPTGNSTADICDPTICLMNDDILLIMVTAVYS
                     CGIPLVNQMNMLKNVLCQVGQTRMAQTLATQKTQNKQCLTQNDYQLLFDYFGKFEKAL
                     EQRKAKKEEAERLKKLEEKLKKEKEKQAEKDRIEAKKFEERMKKEQEKQEEKERKERE
                     KREEKERKEREIREIMERKKREEDDRIAAKLQIAQQLENDRKMREAEESARKETERRA
                     KMETERKVAEARRAVERENQIKMMRAQQLQRRQEEAPPPQQAPAPHTQKIQVKNEPVD
                     HSFDILKEAEKDAHIIPTKSIKAEPLDVQKPLSAFEKLASLRGRTQSADMRRGGDSTE
                     MPNVTQQYQAEQNHLAQSSNNSQYNAPSTSSQPQHFPTEPSIRQPPPQQSYNSNQMLQ
                     NPRQQPQNQIVQNFQSAPQRHPHQNPQIATSSSSGGVNQFYNNGGAAPPVVEQQAANR
                     RSSFTMSHSVQQHQSPLQQQFPINSYQSPSHHNNSSSMSNSSLMQTPHSNSSMIARSP
                     QFPSHTSPMSQRFHTPPSVGHQMVQSPLSQPNPSPLQHFNFSPHSSSFSSQRPQMPPQ
                     RQMSQQNLMHQQQQPQNHTQHQYQHQTFSSQQQQLQQHQHQIRHQMNTNYPPPPGYNH
                     HGH"
ORIGIN      
        1 atgaagcatc ataaaactga aaaagttaat atggaaccgt tgatttattc gttggcgaaa
       61 tcatttggaa tgactacgca agaagttatg aaacaggtcg aacaagaaat ttcgtcgaaa
      121 aaggcaacaa ctccaaaacc ttcaacaaat gcagttttat cgacaatttc atctcaaaaa
      181 tcattggaaa aaaatgcagc cgattggaaa ttaacacaaa cggatttacc cacaatggga
      241 gaaaaagata tacaaatgtt gacgacaatt gttcgatcat ggaaaagtaa aaaagaaata
      301 tcgaattcaa tggtgactgg atggctgaaa gatgtgaatc aattgaaaat gaacgcagat
      361 caagcgagga aaaaattctt cgacatcata aatactttgc cggattcgtc tgaaaaaaat
      421 ggtggtggtg gacagcaaga tgccaacgat attccaaaac acgaacgatc acgtaaagct
      481 cgaatgtttc tccaccaatg ggtctattta tctcgtaaat ttttggagct tcaacttcca
      541 aaattgaaac atcattctcc acctgtcgaa ggtctcgcaa agaagcaagt tatcgctgca
      601 aatgcaataa aagaaggtgt taggaagcaa atttcacttt ttgaaaataa gaaagatcgt
      661 ctgcccggtg atcctgtcta cgtattccag tttacggagc ctgttttaac cgcagtcgcc
      721 ccatacttgg aagatctcgt cgattatgcg ctcgcggcga aaaaaatcga gttaattgta
      781 tccggaatcg acgctctaca ccaatcaact gacggaaaaa ttaccataat tcaattttat
      841 attgaaatct gccgaagact tcagaaatta tcatttctcg ccgttgaaga accaatgaaa
      901 agtcgtctga aagaagcaaa tgaacaaatt atgaagcatc aagttgttca aattccaaaa
      961 tatcaattga aatggcctga tggacaggcg gagccatctc tgaaagggct taatcgagag
     1021 ctttatgaat tcgacaaatc aattctctcc atggtggcgg ctaaaccatc agctcctgca
     1081 actccaaaag cttcatcatc tacagccctc cgcccttcta cgtcatcaac tccatctcag
     1141 cagcaatcca cgtcaactgc aaaagctatg acgtcatcat caacatcagc agaagatgcg
     1201 aagcgcttac tcgcaatgaa tcaacttgtt caggtttacg cgggaaaata tctgctcccg
     1261 accggcaatt caacggcaga catttgtgat ccaacaattt gtctaatgaa tgatgatatt
     1321 ctactgatta tggtaacagc tgtctattcg tgtggtatac cattggttaa tcaaatgaat
     1381 atgcttaaaa atgtcctatg ccaagttggt caaacccgaa tggctcagac attggcaaca
     1441 caaaaaactc aaaataagca gtgcctgacc caaaatgact atcaactact ttttgattat
     1501 tttggaaagt ttgaaaaagc attagaacaa cgaaaagcaa aaaaagaaga agctgaaaga
     1561 ttgaagaaat tggaggaaaa attgaaaaaa gagaaggaga aacaagcaga gaaagataga
     1621 attgaggcga agaaattcga agagcggatg aaaaaagagc aagaaaaaca ggaagaaaaa
     1681 gagagaaaag aacgggaaaa acgagaggaa aaggaaagga aagagagaga aattcgagaa
     1741 attatggaga ggaaaaagag agaagaagac gatcgaattg ctgcgaaatt acaaattgct
     1801 caacaattag agaatgacag gaaaatgaga gaagctgaag aaagtgcacg gaaggagacg
     1861 gaacggaggg ctaaaatgga aactgaacga aaagtggcgg aagctcggcg agcagttgaa
     1921 cgtgagaatc agatcaaaat gatgagggct caacagctgc aaagacggca ggaagaggct
     1981 ccgccccctc aacaagctcc agctccacat acacaaaaga ttcaagtgaa aaatgagcca
     2041 gtagatcatt cattcgatat tctaaaagaa gcagaaaaag atgcacacat aattccaaca
     2101 aaatcaataa aagccgagcc gctggacgtt caaaaaccgc ttagcgcatt tgaaaagctt
     2161 gcatcacttc gtggtaggac ccaatctgct gatatgagaa gaggcgggga ctctacggaa
     2221 atgccgaatg tgacacaaca atatcaagcg gagcaaaatc atctagcaca aagttcgaat
     2281 aattctcagt acaatgcacc aagtacaagt tcccagccac aacatttccc aacagagcct
     2341 tcaatacgcc aaccacctcc ccaacagagt tacaattcca accaaatgct ccaaaatcca
     2401 cgacagcaac cccaaaacca aattgtgcaa aatttccaaa gtgctccgca acgacatccc
     2461 catcaaaatc cgcaaattgc cacgtcatct tcatctggag gagtcaatca gttttataat
     2521 aatggtggag ctgcaccgcc agttgtcgaa caacaagccg ctaatagaag atcatcattc
     2581 acaatgtctc attcagttca acaacaccaa tctcctctcc aacaacaatt tccaatcaat
     2641 tcatatcaat caccgagtca tcataataat agtagctcaa tgagcaattc ctcattaatg
     2701 caaacaccac acagtaatag ttcaatgatt gcacggagtc cacaatttcc atctcatacg
     2761 tccccaatgt cccaacgatt ccatacccca ccatcagttg ggcatcaaat ggtgcagagc
     2821 ccattgtctc aaccgaatcc ttcgcctctt caacatttca acttttcgcc acattcctcc
     2881 agtttttcat cacaaagacc tcaaatgccg ccacaacgtc aaatgagcca acaaaatctc
     2941 atgcatcaac agcaacaacc acaaaatcat actcaacatc agtaccaaca tcagacattc
     3001 agttctcagc aacaacagct tcaacaacat caacaccaaa tccggcacca aatgaatacc
     3061 aactacccac cgccaccagg ctacaatcat catggccatt aa
//