Dbfetch

LOCUS       NM_001312966            3192 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Prion-like-(Q/N-rich)-domain-bearing protein
            (pqn-80), partial mRNA.
ACCESSION   NM_001312966
VERSION     NM_001312966.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3192)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3192)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3192)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3192)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3192
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>3192
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /db_xref="GeneID:176683"
                     /db_xref="WormBase:WBGene00004161"
     CDS             1..3192
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /standard_name="Y111B2A.14k"
                     /note="Product from WormBase gene class pqn;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Prion-like-(Q/N-rich)-domain-bearing protein"
                     /protein_id="NP_001299895.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004161"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14k.1"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14k.2"
                     /db_xref="GeneID:176683"
                     /db_xref="UniProtKB/TrEMBL:A0A0K3ARB9"
                     /db_xref="WormBase:WBGene00004161"
                     /translation="MKHHKTEKVNMEPLIYSLAKSFGMTTQEVMKQVEQEISSKKATT
                     PKPSTNAVLSTISSQKSLEKNAADWKLTQTDLPTMGEKDIQMLTTIVRSWKSKKEISN
                     SMVTGWLKDVNQLKMNADQARKKFFDIINTLPDSSEKNGGGGQQDANDIPKHERSRKA
                     RMFLHQWVYLSRKFLELQLPKLKHHSPPVEGLAKKQVIAANAIKEGVRKQISLFENKK
                     DRLPGDPVYVFQFTEPVLTAVAPYLEDLVDYALAAKKIELIVSGIDALHQSTDGKITI
                     IQFYIEICRRLQKLSFLAVEEPMKSRLKEANEQIMKHQVVQIPKYQLKWPDGQAEPSL
                     KGLNRELYEFDKSILSMVAAKPSAPATPKASSSTALRPSTSSTPSQQQSTSTAKAMTS
                     SSTSAEDAKRLLAMNQLVQVYAGKYLLPTGNSTADICDPTICLMNDDILLIMVTAVYS
                     CGIPLVNQMNMLKNVLCQVGQTRMAQTLATQKTQNKQCLTQNDYQLLFDYFGKFEKAL
                     EQRKAKKEEAERLKKLEEKLKKEKEKQAEKDRIEAKKFEERMKKEQEKQEEKERKERE
                     KREEKERKEREIREIMERKKREEDDRIAAKLQIAQQLENDRKMREAEESARKETERRA
                     KMETEAANALQGLEEDLLMDDIDFMTQQQTKVDEERKVAEARRAVERENQIKMMRAQQ
                     LQRRQEEAPPPQQAPAPHTQKIQVKNEPVDHSFDILKEAEKDAHIIPTKSIKAEPLDV
                     QKPLSAFEKLASLRGRTQSADMRRGGDSTEMPNVTQQYQAEQNHLAQSSNNSQYNAPS
                     TSSQPQHFPTEPSIRQPPPQQSYNSNQMLQNPRQQPQNQIVQNFQSAPQRHPHQNPQI
                     ATSSSSGGVNQFYNNGGAAPPVVEQQAANRRSSFTMSHSVQQHQSPLQQQFPINSYQS
                     PSHHNNSSSMSNSSLMQTPHSNSSMIARSPQFPSHTSPMSQRFHTPPSVGHQMVQSPL
                     SQPNPSPLQHFNFSPHSSSFSSQRPQMPPQRQMSQQNLMHQQQQPQNHTQHQYQHQTF
                     SSQQQQLQQHQHQIRHQMNTNYPPPPGYNHHGH"
ORIGIN      
        1 atgaagcatc ataaaactga aaaagttaat atggaaccgt tgatttattc gttggcgaaa
       61 tcatttggaa tgactacgca agaagttatg aaacaggtcg aacaagaaat ttcgtcgaaa
      121 aaggcaacaa ctccaaaacc ttcaacaaat gcagttttat cgacaatttc atctcaaaaa
      181 tcattggaaa aaaatgcagc cgattggaaa ttaacacaaa cggatttacc cacaatggga
      241 gaaaaagata tacaaatgtt gacgacaatt gttcgatcat ggaaaagtaa aaaagaaata
      301 tcgaattcaa tggtgactgg atggctgaaa gatgtgaatc aattgaaaat gaacgcagat
      361 caagcgagga aaaaattctt cgacatcata aatactttgc cggattcgtc tgaaaaaaat
      421 ggtggtggtg gacagcaaga tgccaacgat attccaaaac acgaacgatc acgtaaagct
      481 cgaatgtttc tccaccaatg ggtctattta tctcgtaaat ttttggagct tcaacttcca
      541 aaattgaaac atcattctcc acctgtcgaa ggtctcgcaa agaagcaagt tatcgctgca
      601 aatgcaataa aagaaggtgt taggaagcaa atttcacttt ttgaaaataa gaaagatcgt
      661 ctgcccggtg atcctgtcta cgtattccag tttacggagc ctgttttaac cgcagtcgcc
      721 ccatacttgg aagatctcgt cgattatgcg ctcgcggcga aaaaaatcga gttaattgta
      781 tccggaatcg acgctctaca ccaatcaact gacggaaaaa ttaccataat tcaattttat
      841 attgaaatct gccgaagact tcagaaatta tcatttctcg ccgttgaaga accaatgaaa
      901 agtcgtctga aagaagcaaa tgaacaaatt atgaagcatc aagttgttca aattccaaaa
      961 tatcaattga aatggcctga tggacaggcg gagccatctc tgaaagggct taatcgagag
     1021 ctttatgaat tcgacaaatc aattctctcc atggtggcgg ctaaaccatc agctcctgca
     1081 actccaaaag cttcatcatc tacagccctc cgcccttcta cgtcatcaac tccatctcag
     1141 cagcaatcca cgtcaactgc aaaagctatg acgtcatcat caacatcagc agaagatgcg
     1201 aagcgcttac tcgcaatgaa tcaacttgtt caggtttacg cgggaaaata tctgctcccg
     1261 accggcaatt caacggcaga catttgtgat ccaacaattt gtctaatgaa tgatgatatt
     1321 ctactgatta tggtaacagc tgtctattcg tgtggtatac cattggttaa tcaaatgaat
     1381 atgcttaaaa atgtcctatg ccaagttggt caaacccgaa tggctcagac attggcaaca
     1441 caaaaaactc aaaataagca gtgcctgacc caaaatgact atcaactact ttttgattat
     1501 tttggaaagt ttgaaaaagc attagaacaa cgaaaagcaa aaaaagaaga agctgaaaga
     1561 ttgaagaaat tggaggaaaa attgaaaaaa gagaaggaga aacaagcaga gaaagataga
     1621 attgaggcga agaaattcga agagcggatg aaaaaagagc aagaaaaaca ggaagaaaaa
     1681 gagagaaaag aacgggaaaa acgagaggaa aaggaaagga aagagagaga aattcgagaa
     1741 attatggaga ggaaaaagag agaagaagac gatcgaattg ctgcgaaatt acaaattgct
     1801 caacaattag agaatgacag gaaaatgaga gaagctgaag aaagtgcacg gaaggagacg
     1861 gaacggaggg ctaaaatgga aactgaagca gcaaatgcac tacaaggact cgaagaggac
     1921 cttctcatgg atgatatcga ttttatgact caacaacaaa caaaagtcga tgaggaacga
     1981 aaagtggcgg aagctcggcg agcagttgaa cgtgagaatc agatcaaaat gatgagggct
     2041 caacagctgc aaagacggca ggaagaggct ccgccccctc aacaagctcc agctccacat
     2101 acacaaaaga ttcaagtgaa aaatgagcca gtagatcatt cattcgatat tctaaaagaa
     2161 gcagaaaaag atgcacacat aattccaaca aaatcaataa aagccgagcc gctggacgtt
     2221 caaaaaccgc ttagcgcatt tgaaaagctt gcatcacttc gtggtaggac ccaatctgct
     2281 gatatgagaa gaggcgggga ctctacggaa atgccgaatg tgacacaaca atatcaagcg
     2341 gagcaaaatc atctagcaca aagttcgaat aattctcagt acaatgcacc aagtacaagt
     2401 tcccagccac aacatttccc aacagagcct tcaatacgcc aaccacctcc ccaacagagt
     2461 tacaattcca accaaatgct ccaaaatcca cgacagcaac cccaaaacca aattgtgcaa
     2521 aatttccaaa gtgctccgca acgacatccc catcaaaatc cgcaaattgc cacgtcatct
     2581 tcatctggag gagtcaatca gttttataat aatggtggag ctgcaccgcc agttgtcgaa
     2641 caacaagccg ctaatagaag atcatcattc acaatgtctc attcagttca acaacaccaa
     2701 tctcctctcc aacaacaatt tccaatcaat tcatatcaat caccgagtca tcataataat
     2761 agtagctcaa tgagcaattc ctcattaatg caaacaccac acagtaatag ttcaatgatt
     2821 gcacggagtc cacaatttcc atctcatacg tccccaatgt cccaacgatt ccatacccca
     2881 ccatcagttg ggcatcaaat ggtgcagagc ccattgtctc aaccgaatcc ttcgcctctt
     2941 caacatttca acttttcgcc acattcctcc agtttttcat cacaaagacc tcaaatgccg
     3001 ccacaacgtc aaatgagcca acaaaatctc atgcatcaac agcaacaacc acaaaatcat
     3061 actcaacatc agtaccaaca tcagacattc agttctcagc aacaacagct tcaacaacat
     3121 caacaccaaa tccggcacca aatgaatacc aactacccac cgccaccagg ctacaatcat
     3181 catggccatt aa
//