Dbfetch

LOCUS       NM_001312965            3111 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Prion-like-(Q/N-rich)-domain-bearing protein
            (pqn-80), partial mRNA.
ACCESSION   NM_001312965
VERSION     NM_001312965.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3111)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3111)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3111)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3111)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3111
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>3111
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /db_xref="GeneID:176683"
                     /db_xref="WormBase:WBGene00004161"
     CDS             1..3111
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /standard_name="Y111B2A.14j"
                     /note="Product from WormBase gene class pqn;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Prion-like-(Q/N-rich)-domain-bearing protein"
                     /protein_id="NP_001299894.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004161"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14j.1"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14j.2"
                     /db_xref="GeneID:176683"
                     /db_xref="UniProtKB/TrEMBL:A0A0K3AU69"
                     /db_xref="WormBase:WBGene00004161"
                     /translation="MKHHKTEKVNMEPLIYSLAKSFGMTTQEVMKQVEQEISSKKATT
                     PKPSTNAVLSTISSQKSLEKNAADWKLTQTDLPTMGEKDIQMLTTIVRSWKSKKEISN
                     SMVTGWLKDVNQLKMNADQARKKFFDIINTLPDSSEKNGGGGQQDANDIPKHERSRKA
                     RMFLHQWVYLSRKFLELQLPKLKHHSPPVEGLAKKQVIAANAIKEGVRKQISLFENKK
                     ETSSRLPGDPVYVFQFTEPVLTAVAPYLEDLVDYALAAKKIELIVSGIDALHQSTDGK
                     ITIIQFYIEICRRLQKLSFLAVEEPMKSRLKEANEQIMKHQVVQIPKYQLKWPDGQAE
                     PSLKGLNRELYEFDKSILSMVAAKPSAPATPKASSSTALRPSTSSTPSQQQSTSTAKA
                     MTSSSTSAEDAKRLLAMNQLVQVYAGKYLLPTGNSTADICDPTICLMNDDILLIMVTA
                     VYSCGIPLVNQMNMLKNVLCQVGQTRMAQTLATQKTQNKQCLTQNDYQLLFDYFGKFE
                     KALEQRKAKKEEAERLKKLEEKLKKEKEKQAEKDRIEAKKFEERMKKEQEKQEEKERK
                     EREKREEKERKEREIREIMERKKREEDDRIAAKLQIAQQLENDRKMREAEESARKETE
                     RRAKMETERKVAEARRAVERENQIKMMRAQQLQRRQEEAPPPQQAPAPHTQKIQVKNE
                     PVDHSFDILKEAEKDAHIIPTKSIKAEPLDVQKPLSAFEKLASLRGRTQSADMRRGGD
                     STEMPNVTQQYQAEQNHLAQSSNNSQYNAPSTSSQPQHFPTEPSIRQPPPQQSYNSNQ
                     MLQNPRQQPQNQIVQNFQSAPQRHPHQNPQIATSSSSGGVNQFYNNGGAAPPVVEQQA
                     ANRRSSFTMSHSVQQHQSPLQQQFPINSYQSPSHHNNSSSMSNSSLMQTPHSNSSMIA
                     RSPQFPSHTSPMSQRFHTPPSVGHQMVQSPLSQPNPSPLQHFNFSPHSSSFSSQRPQM
                     PPQRQMSQQNLMHQQQQPQNHTQHQYQHQTFSSQQQQLQQHQHQIRHQMNTNYPPPPG
                     YNHHGH"
ORIGIN      
        1 atgaagcatc ataaaactga aaaagttaat atggaaccgt tgatttattc gttggcgaaa
       61 tcatttggaa tgactacgca agaagttatg aaacaggtcg aacaagaaat ttcgtcgaaa
      121 aaggcaacaa ctccaaaacc ttcaacaaat gcagttttat cgacaatttc atctcaaaaa
      181 tcattggaaa aaaatgcagc cgattggaaa ttaacacaaa cggatttacc cacaatggga
      241 gaaaaagata tacaaatgtt gacgacaatt gttcgatcat ggaaaagtaa aaaagaaata
      301 tcgaattcaa tggtgactgg atggctgaaa gatgtgaatc aattgaaaat gaacgcagat
      361 caagcgagga aaaaattctt cgacatcata aatactttgc cggattcgtc tgaaaaaaat
      421 ggtggtggtg gacagcaaga tgccaacgat attccaaaac acgaacgatc acgtaaagct
      481 cgaatgtttc tccaccaatg ggtctattta tctcgtaaat ttttggagct tcaacttcca
      541 aaattgaaac atcattctcc acctgtcgaa ggtctcgcaa agaagcaagt tatcgctgca
      601 aatgcaataa aagaaggtgt taggaagcaa atttcacttt ttgaaaataa gaaagaaact
      661 tccagtcgtc tgcccggtga tcctgtctac gtattccagt ttacggagcc tgttttaacc
      721 gcagtcgccc catacttgga agatctcgtc gattatgcgc tcgcggcgaa aaaaatcgag
      781 ttaattgtat ccggaatcga cgctctacac caatcaactg acggaaaaat taccataatt
      841 caattttata ttgaaatctg ccgaagactt cagaaattat catttctcgc cgttgaagaa
      901 ccaatgaaaa gtcgtctgaa agaagcaaat gaacaaatta tgaagcatca agttgttcaa
      961 attccaaaat atcaattgaa atggcctgat ggacaggcgg agccatctct gaaagggctt
     1021 aatcgagagc tttatgaatt cgacaaatca attctctcca tggtggcggc taaaccatca
     1081 gctcctgcaa ctccaaaagc ttcatcatct acagccctcc gcccttctac gtcatcaact
     1141 ccatctcagc agcaatccac gtcaactgca aaagctatga cgtcatcatc aacatcagca
     1201 gaagatgcga agcgcttact cgcaatgaat caacttgttc aggtttacgc gggaaaatat
     1261 ctgctcccga ccggcaattc aacggcagac atttgtgatc caacaatttg tctaatgaat
     1321 gatgatattc tactgattat ggtaacagct gtctattcgt gtggtatacc attggttaat
     1381 caaatgaata tgcttaaaaa tgtcctatgc caagttggtc aaacccgaat ggctcagaca
     1441 ttggcaacac aaaaaactca aaataagcag tgcctgaccc aaaatgacta tcaactactt
     1501 tttgattatt ttggaaagtt tgaaaaagca ttagaacaac gaaaagcaaa aaaagaagaa
     1561 gctgaaagat tgaagaaatt ggaggaaaaa ttgaaaaaag agaaggagaa acaagcagag
     1621 aaagatagaa ttgaggcgaa gaaattcgaa gagcggatga aaaaagagca agaaaaacag
     1681 gaagaaaaag agagaaaaga acgggaaaaa cgagaggaaa aggaaaggaa agagagagaa
     1741 attcgagaaa ttatggagag gaaaaagaga gaagaagacg atcgaattgc tgcgaaatta
     1801 caaattgctc aacaattaga gaatgacagg aaaatgagag aagctgaaga aagtgcacgg
     1861 aaggagacgg aacggagggc taaaatggaa actgaacgaa aagtggcgga agctcggcga
     1921 gcagttgaac gtgagaatca gatcaaaatg atgagggctc aacagctgca aagacggcag
     1981 gaagaggctc cgccccctca acaagctcca gctccacata cacaaaagat tcaagtgaaa
     2041 aatgagccag tagatcattc attcgatatt ctaaaagaag cagaaaaaga tgcacacata
     2101 attccaacaa aatcaataaa agccgagccg ctggacgttc aaaaaccgct tagcgcattt
     2161 gaaaagcttg catcacttcg tggtaggacc caatctgctg atatgagaag aggcggggac
     2221 tctacggaaa tgccgaatgt gacacaacaa tatcaagcgg agcaaaatca tctagcacaa
     2281 agttcgaata attctcagta caatgcacca agtacaagtt cccagccaca acatttccca
     2341 acagagcctt caatacgcca accacctccc caacagagtt acaattccaa ccaaatgctc
     2401 caaaatccac gacagcaacc ccaaaaccaa attgtgcaaa atttccaaag tgctccgcaa
     2461 cgacatcccc atcaaaatcc gcaaattgcc acgtcatctt catctggagg agtcaatcag
     2521 ttttataata atggtggagc tgcaccgcca gttgtcgaac aacaagccgc taatagaaga
     2581 tcatcattca caatgtctca ttcagttcaa caacaccaat ctcctctcca acaacaattt
     2641 ccaatcaatt catatcaatc accgagtcat cataataata gtagctcaat gagcaattcc
     2701 tcattaatgc aaacaccaca cagtaatagt tcaatgattg cacggagtcc acaatttcca
     2761 tctcatacgt ccccaatgtc ccaacgattc cataccccac catcagttgg gcatcaaatg
     2821 gtgcagagcc cattgtctca accgaatcct tcgcctcttc aacatttcaa cttttcgcca
     2881 cattcctcca gtttttcatc acaaagacct caaatgccgc cacaacgtca aatgagccaa
     2941 caaaatctca tgcatcaaca gcaacaacca caaaatcata ctcaacatca gtaccaacat
     3001 cagacattca gttctcagca acaacagctt caacaacatc aacaccaaat ccggcaccaa
     3061 atgaatacca actacccacc gccaccaggc tacaatcatc atggccatta a
//