Dbfetch

LOCUS       NM_001312963            3672 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Prion-like-(Q/N-rich)-domain-bearing protein
            (pqn-80), partial mRNA.
ACCESSION   NM_001312963
VERSION     NM_001312963.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3672)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3672)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3672)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3672)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3672
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>3672
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /db_xref="GeneID:176683"
                     /db_xref="WormBase:WBGene00004161"
     CDS             1..3672
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /standard_name="Y111B2A.14h"
                     /note="Product from WormBase gene class pqn;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Prion-like-(Q/N-rich)-domain-bearing protein"
                     /protein_id="NP_001299892.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004161"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14h.1"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14h.2"
                     /db_xref="GeneID:176683"
                     /db_xref="UniProtKB/TrEMBL:A0A0K3AX79"
                     /db_xref="WormBase:WBGene00004161"
                     /translation="MTGAPPSIRMVSSSSSLKKLPAPRKPSPPPAVEPTRSVEIIEKP
                     EKTEKPAEKRKTAATTSALEPAEKKKKPDSSSSSEEIILIDDNAPAAKKQPESAQKGS
                     TTVTMSAKKICKQQEEIAKQKPSSSSVTPSKPAAPTASTPKKEEIGTLETFLKNIFAN
                     LDAKGKLYQEKKLKTFDTETLKEITTFIDVMKHHKTEKVNMEPLIYSLAKSFGMTTQE
                     VMKQVEQEISSKKATTPKPSTNAVLSTISSQKSLEKNAADWKLTQTDLPTMGEKDIQM
                     LTTIVRSWKSKKEISNSMVTGWLKDVNQLKMNADQARKKFFDIINTLPDSSEKNGGGG
                     QQDANDIPKHERSRKARMFLHQWVYLSRKFLELQLPKLKHHSPPVEGLAKKQVIAANA
                     IKEGVRKQISLFENKKDRLPGDPVYVFQFTEPVLTAVAPYLEDLVDYALAAKKIELIV
                     SGIDALHQSTDGKITIIQFYIEICRRLQKLSFLAVEEPMKSRLKEANEQIMKHQVVQI
                     PKYQLKWPDGQAEPSLKGLNRELYEFDKSILSMVAAKPSAPATPKASSSTALRPSTSS
                     TPSQQQSTSTAKAMTSSSTSAEDAKRLLAMNQLVQVYAGKYLLPTGNSTADICDPTIC
                     LMNDDILLIMVTAVYSCGIPLVNQMNMLKNVLCQVGQTRMAQTLATQKTQNKQCLTQN
                     DYQLLFDYFGKFEKALEQRKAKKEEAERLKKLEEKLKKEKEKQAEKDRIEAKKFEERM
                     KKEQEKQEEKERKEREKREEKERKEREIREIMERKKREEDDRIAAKLQIAQQLENDRK
                     MREAEESARKETERRAKMETERKVAEARRAVERENQIKMMRAQQLQRRQEEAPPPQQA
                     PAPHTQKIQVKNEPVDHSFDILKEAEKDAHIIPTKSIKAEPLDVQKPLSAFEKLASLR
                     GRTQSADMRRGGDSTEMPNVTQQYQAEQNHLAQSSNNSQYNAPSTSSQPQHFPTEPSI
                     RQPPPQQSYNSNQMLQNPRQQPQNQIVQNFQSAPQRHPHQNPQIATSSSSGGVNQFYN
                     NGGAAPPVVEQQAANRRSSFTMSHSVQQHQSPLQQQFPINSYQSPSHHNNSSSMSNSS
                     LMQTPHSNSSMIARSPQFPSHTSPMSQRFHTPPSVGHQMVQSPLSQPNPSPLQHFNFS
                     PHSSSFSSQRPQMPPQRQMSQQNLMHQQQQPQNHTQHQYQHQTFSSQQQQLQQHQHQI
                     RHQMNTNYPPPPGYNHHGH"
ORIGIN      
        1 atgacaggag ctccaccgtc aattcgaatg gtttcttctt cttcttcttt gaagaagctt
       61 ccggcccctc gaaaaccatc cccgccgccg gctgtagagc ccacaagatc tgtggaaatt
      121 attgagaagc ctgaaaagac tgaaaagccc gccgaaaagc gaaaaaccgc ggccaccaca
      181 tccgcactgg agcctgctga aaagaagaaa aagccggata gtagtagtag ttcggaggag
      241 ataattctta ttgatgataa tgctccggct gcaaagaagc agccggaaag tgctcaaaaa
      301 gggtccacca cagtcaccat gtcagccaag aaaatctgca aacaacagga agaaatcgct
      361 aagcagaagc cgtcatcatc atctgtaact ccatcaaaac cagctgctcc aacagcttca
      421 acaccgaaaa aagaggaaat cgggactctt gagacgttcc tgaagaatat atttgcaaat
      481 ttagatgcaa aagggaaact ttatcaggag aaaaagttga aaactttcga tacggagact
      541 ttaaaggaga taacaacgtt tatagatgta atgaagcatc ataaaactga aaaagttaat
      601 atggaaccgt tgatttattc gttggcgaaa tcatttggaa tgactacgca agaagttatg
      661 aaacaggtcg aacaagaaat ttcgtcgaaa aaggcaacaa ctccaaaacc ttcaacaaat
      721 gcagttttat cgacaatttc atctcaaaaa tcattggaaa aaaatgcagc cgattggaaa
      781 ttaacacaaa cggatttacc cacaatggga gaaaaagata tacaaatgtt gacgacaatt
      841 gttcgatcat ggaaaagtaa aaaagaaata tcgaattcaa tggtgactgg atggctgaaa
      901 gatgtgaatc aattgaaaat gaacgcagat caagcgagga aaaaattctt cgacatcata
      961 aatactttgc cggattcgtc tgaaaaaaat ggtggtggtg gacagcaaga tgccaacgat
     1021 attccaaaac acgaacgatc acgtaaagct cgaatgtttc tccaccaatg ggtctattta
     1081 tctcgtaaat ttttggagct tcaacttcca aaattgaaac atcattctcc acctgtcgaa
     1141 ggtctcgcaa agaagcaagt tatcgctgca aatgcaataa aagaaggtgt taggaagcaa
     1201 atttcacttt ttgaaaataa gaaagatcgt ctgcccggtg atcctgtcta cgtattccag
     1261 tttacggagc ctgttttaac cgcagtcgcc ccatacttgg aagatctcgt cgattatgcg
     1321 ctcgcggcga aaaaaatcga gttaattgta tccggaatcg acgctctaca ccaatcaact
     1381 gacggaaaaa ttaccataat tcaattttat attgaaatct gccgaagact tcagaaatta
     1441 tcatttctcg ccgttgaaga accaatgaaa agtcgtctga aagaagcaaa tgaacaaatt
     1501 atgaagcatc aagttgttca aattccaaaa tatcaattga aatggcctga tggacaggcg
     1561 gagccatctc tgaaagggct taatcgagag ctttatgaat tcgacaaatc aattctctcc
     1621 atggtggcgg ctaaaccatc agctcctgca actccaaaag cttcatcatc tacagccctc
     1681 cgcccttcta cgtcatcaac tccatctcag cagcaatcca cgtcaactgc aaaagctatg
     1741 acgtcatcat caacatcagc agaagatgcg aagcgcttac tcgcaatgaa tcaacttgtt
     1801 caggtttacg cgggaaaata tctgctcccg accggcaatt caacggcaga catttgtgat
     1861 ccaacaattt gtctaatgaa tgatgatatt ctactgatta tggtaacagc tgtctattcg
     1921 tgtggtatac cattggttaa tcaaatgaat atgcttaaaa atgtcctatg ccaagttggt
     1981 caaacccgaa tggctcagac attggcaaca caaaaaactc aaaataagca gtgcctgacc
     2041 caaaatgact atcaactact ttttgattat tttggaaagt ttgaaaaagc attagaacaa
     2101 cgaaaagcaa aaaaagaaga agctgaaaga ttgaagaaat tggaggaaaa attgaaaaaa
     2161 gagaaggaga aacaagcaga gaaagataga attgaggcga agaaattcga agagcggatg
     2221 aaaaaagagc aagaaaaaca ggaagaaaaa gagagaaaag aacgggaaaa acgagaggaa
     2281 aaggaaagga aagagagaga aattcgagaa attatggaga ggaaaaagag agaagaagac
     2341 gatcgaattg ctgcgaaatt acaaattgct caacaattag agaatgacag gaaaatgaga
     2401 gaagctgaag aaagtgcacg gaaggagacg gaacggaggg ctaaaatgga aactgaacga
     2461 aaagtggcgg aagctcggcg agcagttgaa cgtgagaatc agatcaaaat gatgagggct
     2521 caacagctgc aaagacggca ggaagaggct ccgccccctc aacaagctcc agctccacat
     2581 acacaaaaga ttcaagtgaa aaatgagcca gtagatcatt cattcgatat tctaaaagaa
     2641 gcagaaaaag atgcacacat aattccaaca aaatcaataa aagccgagcc gctggacgtt
     2701 caaaaaccgc ttagcgcatt tgaaaagctt gcatcacttc gtggtaggac ccaatctgct
     2761 gatatgagaa gaggcgggga ctctacggaa atgccgaatg tgacacaaca atatcaagcg
     2821 gagcaaaatc atctagcaca aagttcgaat aattctcagt acaatgcacc aagtacaagt
     2881 tcccagccac aacatttccc aacagagcct tcaatacgcc aaccacctcc ccaacagagt
     2941 tacaattcca accaaatgct ccaaaatcca cgacagcaac cccaaaacca aattgtgcaa
     3001 aatttccaaa gtgctccgca acgacatccc catcaaaatc cgcaaattgc cacgtcatct
     3061 tcatctggag gagtcaatca gttttataat aatggtggag ctgcaccgcc agttgtcgaa
     3121 caacaagccg ctaatagaag atcatcattc acaatgtctc attcagttca acaacaccaa
     3181 tctcctctcc aacaacaatt tccaatcaat tcatatcaat caccgagtca tcataataat
     3241 agtagctcaa tgagcaattc ctcattaatg caaacaccac acagtaatag ttcaatgatt
     3301 gcacggagtc cacaatttcc atctcatacg tccccaatgt cccaacgatt ccatacccca
     3361 ccatcagttg ggcatcaaat ggtgcagagc ccattgtctc aaccgaatcc ttcgcctctt
     3421 caacatttca acttttcgcc acattcctcc agtttttcat cacaaagacc tcaaatgccg
     3481 ccacaacgtc aaatgagcca acaaaatctc atgcatcaac agcaacaacc acaaaatcat
     3541 actcaacatc agtaccaaca tcagacattc agttctcagc aacaacagct tcaacaacat
     3601 caacaccaaa tccggcacca aatgaatacc aactacccac cgccaccagg ctacaatcat
     3661 catggccatt aa
//