Dbfetch

LOCUS       NM_001312962            3762 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Prion-like-(Q/N-rich)-domain-bearing protein
            (pqn-80), partial mRNA.
ACCESSION   NM_001312962
VERSION     NM_001312962.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3762)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3762)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3762)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3762)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3762
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>3762
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /db_xref="GeneID:176683"
                     /db_xref="WormBase:WBGene00004161"
     CDS             1..3762
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /standard_name="Y111B2A.14g"
                     /note="Product from WormBase gene class pqn;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Prion-like-(Q/N-rich)-domain-bearing protein"
                     /protein_id="NP_001299891.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004161"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14g.1"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14g.2"
                     /db_xref="GeneID:176683"
                     /db_xref="UniProtKB/TrEMBL:A0A0K3AUW7"
                     /db_xref="WormBase:WBGene00004161"
                     /translation="MTGAPPSIRMVSSSSSLKKLPAPRKPSPPPAVEPTRSVEIIEKP
                     EKTEKPAEKRKTAATTSALEPAEKKKKPDSSSSSEEIILIDDNAPAAKKQPESAQKGS
                     TTVTMSAKKICKQQEEIAKQKPSSSSVTPSKPAAPTASTPKKEEIGTLETFLKNIFAN
                     LDAKGKLYQEKKLKTFDTETLKEITTFIDVMKHHKTEKVNMEPLIYSLAKSFGMTTQE
                     VMKQVEQEISSKKATTPKPSTNAVLSTISSQKSLEKNAADWKLTQTDLPTMGEKDIQM
                     LTTIVRSWKSKKEISNSMVTGWLKDVNQLKMNADQARKKFFDIINTLPDSSEKNGGGG
                     QQDANDIPKHERSRKARMFLHQWVYLSRKFLELQLPKLKHHSPPVEGLAKKQVIAANA
                     IKEGVRKQISLFENKKDRLPGDPVYVFQFTEPVLTAVAPYLEDLVDYALAAKKIELIV
                     SGIDALHQSTDGKITIIQFYIEICRRLQKLSFLAVEEPMKSRLKEANEQIMKHQVVQI
                     PKYQLKWPDGQAEPSLKGLNRELYEFDKSILSMVAAKPSAPATPKASSSTALRPSTSS
                     TPSQQQSTSTAKAMTSSSTSAEDAKRLLAMNQLVQVYAGKYLLPTGNSTADICDPTIC
                     LMNDDILLIMVTAVYSCGIPLVNQMNMLKNVLCQVGQTRMAQTLATQKTQNKQCLTQN
                     DYQLLFDYFGKFEKALEQRKAKKEEAERLKKLEEKLKKEKEKQAEKDRIEAKKFEERM
                     KKEQEKQEEKERKEREKREEKERKEREIREIMERKKREEDDRIAAKLQIAQQLENDRK
                     MREAEESARKETERRAKMETEAANALQGLEEDLLMDDIDFMTQQQTKVDEERKVAEAR
                     RAVERENQIKMMRAQQLQRRQEEAPPPQQAPAPHTQKIQVKNEPVDHSFDILKEAEKD
                     AHIIPTKSIKAEPLDVQKPLSAFEKLASLRGRTQSADMRRGGDSTEMPNVTQQYQAEQ
                     NHLAQSSNNSQYNAPSTSSQPQHFPTEPSIRQPPPQQSYNSNQMLQNPRQQPQNQIVQ
                     NFQSAPQRHPHQNPQIATSSSSGGVNQFYNNGGAAPPVVEQQAANRRSSFTMSHSVQQ
                     HQSPLQQQFPINSYQSPSHHNNSSSMSNSSLMQTPHSNSSMIARSPQFPSHTSPMSQR
                     FHTPPSVGHQMVQSPLSQPNPSPLQHFNFSPHSSSFSSQRPQMPPQRQMSQQNLMHQQ
                     QQPQNHTQHQYQHQTFSSQQQQLQQHQHQIRHQMNTNYPPPPGYNHHGH"
ORIGIN      
        1 atgacaggag ctccaccgtc aattcgaatg gtttcttctt cttcttcttt gaagaagctt
       61 ccggcccctc gaaaaccatc cccgccgccg gctgtagagc ccacaagatc tgtggaaatt
      121 attgagaagc ctgaaaagac tgaaaagccc gccgaaaagc gaaaaaccgc ggccaccaca
      181 tccgcactgg agcctgctga aaagaagaaa aagccggata gtagtagtag ttcggaggag
      241 ataattctta ttgatgataa tgctccggct gcaaagaagc agccggaaag tgctcaaaaa
      301 gggtccacca cagtcaccat gtcagccaag aaaatctgca aacaacagga agaaatcgct
      361 aagcagaagc cgtcatcatc atctgtaact ccatcaaaac cagctgctcc aacagcttca
      421 acaccgaaaa aagaggaaat cgggactctt gagacgttcc tgaagaatat atttgcaaat
      481 ttagatgcaa aagggaaact ttatcaggag aaaaagttga aaactttcga tacggagact
      541 ttaaaggaga taacaacgtt tatagatgta atgaagcatc ataaaactga aaaagttaat
      601 atggaaccgt tgatttattc gttggcgaaa tcatttggaa tgactacgca agaagttatg
      661 aaacaggtcg aacaagaaat ttcgtcgaaa aaggcaacaa ctccaaaacc ttcaacaaat
      721 gcagttttat cgacaatttc atctcaaaaa tcattggaaa aaaatgcagc cgattggaaa
      781 ttaacacaaa cggatttacc cacaatggga gaaaaagata tacaaatgtt gacgacaatt
      841 gttcgatcat ggaaaagtaa aaaagaaata tcgaattcaa tggtgactgg atggctgaaa
      901 gatgtgaatc aattgaaaat gaacgcagat caagcgagga aaaaattctt cgacatcata
      961 aatactttgc cggattcgtc tgaaaaaaat ggtggtggtg gacagcaaga tgccaacgat
     1021 attccaaaac acgaacgatc acgtaaagct cgaatgtttc tccaccaatg ggtctattta
     1081 tctcgtaaat ttttggagct tcaacttcca aaattgaaac atcattctcc acctgtcgaa
     1141 ggtctcgcaa agaagcaagt tatcgctgca aatgcaataa aagaaggtgt taggaagcaa
     1201 atttcacttt ttgaaaataa gaaagatcgt ctgcccggtg atcctgtcta cgtattccag
     1261 tttacggagc ctgttttaac cgcagtcgcc ccatacttgg aagatctcgt cgattatgcg
     1321 ctcgcggcga aaaaaatcga gttaattgta tccggaatcg acgctctaca ccaatcaact
     1381 gacggaaaaa ttaccataat tcaattttat attgaaatct gccgaagact tcagaaatta
     1441 tcatttctcg ccgttgaaga accaatgaaa agtcgtctga aagaagcaaa tgaacaaatt
     1501 atgaagcatc aagttgttca aattccaaaa tatcaattga aatggcctga tggacaggcg
     1561 gagccatctc tgaaagggct taatcgagag ctttatgaat tcgacaaatc aattctctcc
     1621 atggtggcgg ctaaaccatc agctcctgca actccaaaag cttcatcatc tacagccctc
     1681 cgcccttcta cgtcatcaac tccatctcag cagcaatcca cgtcaactgc aaaagctatg
     1741 acgtcatcat caacatcagc agaagatgcg aagcgcttac tcgcaatgaa tcaacttgtt
     1801 caggtttacg cgggaaaata tctgctcccg accggcaatt caacggcaga catttgtgat
     1861 ccaacaattt gtctaatgaa tgatgatatt ctactgatta tggtaacagc tgtctattcg
     1921 tgtggtatac cattggttaa tcaaatgaat atgcttaaaa atgtcctatg ccaagttggt
     1981 caaacccgaa tggctcagac attggcaaca caaaaaactc aaaataagca gtgcctgacc
     2041 caaaatgact atcaactact ttttgattat tttggaaagt ttgaaaaagc attagaacaa
     2101 cgaaaagcaa aaaaagaaga agctgaaaga ttgaagaaat tggaggaaaa attgaaaaaa
     2161 gagaaggaga aacaagcaga gaaagataga attgaggcga agaaattcga agagcggatg
     2221 aaaaaagagc aagaaaaaca ggaagaaaaa gagagaaaag aacgggaaaa acgagaggaa
     2281 aaggaaagga aagagagaga aattcgagaa attatggaga ggaaaaagag agaagaagac
     2341 gatcgaattg ctgcgaaatt acaaattgct caacaattag agaatgacag gaaaatgaga
     2401 gaagctgaag aaagtgcacg gaaggagacg gaacggaggg ctaaaatgga aactgaagca
     2461 gcaaatgcac tacaaggact cgaagaggac cttctcatgg atgatatcga ttttatgact
     2521 caacaacaaa caaaagtcga tgaggaacga aaagtggcgg aagctcggcg agcagttgaa
     2581 cgtgagaatc agatcaaaat gatgagggct caacagctgc aaagacggca ggaagaggct
     2641 ccgccccctc aacaagctcc agctccacat acacaaaaga ttcaagtgaa aaatgagcca
     2701 gtagatcatt cattcgatat tctaaaagaa gcagaaaaag atgcacacat aattccaaca
     2761 aaatcaataa aagccgagcc gctggacgtt caaaaaccgc ttagcgcatt tgaaaagctt
     2821 gcatcacttc gtggtaggac ccaatctgct gatatgagaa gaggcgggga ctctacggaa
     2881 atgccgaatg tgacacaaca atatcaagcg gagcaaaatc atctagcaca aagttcgaat
     2941 aattctcagt acaatgcacc aagtacaagt tcccagccac aacatttccc aacagagcct
     3001 tcaatacgcc aaccacctcc ccaacagagt tacaattcca accaaatgct ccaaaatcca
     3061 cgacagcaac cccaaaacca aattgtgcaa aatttccaaa gtgctccgca acgacatccc
     3121 catcaaaatc cgcaaattgc cacgtcatct tcatctggag gagtcaatca gttttataat
     3181 aatggtggag ctgcaccgcc agttgtcgaa caacaagccg ctaatagaag atcatcattc
     3241 acaatgtctc attcagttca acaacaccaa tctcctctcc aacaacaatt tccaatcaat
     3301 tcatatcaat caccgagtca tcataataat agtagctcaa tgagcaattc ctcattaatg
     3361 caaacaccac acagtaatag ttcaatgatt gcacggagtc cacaatttcc atctcatacg
     3421 tccccaatgt cccaacgatt ccatacccca ccatcagttg ggcatcaaat ggtgcagagc
     3481 ccattgtctc aaccgaatcc ttcgcctctt caacatttca acttttcgcc acattcctcc
     3541 agtttttcat cacaaagacc tcaaatgccg ccacaacgtc aaatgagcca acaaaatctc
     3601 atgcatcaac agcaacaacc acaaaatcat actcaacatc agtaccaaca tcagacattc
     3661 agttctcagc aacaacagct tcaacaacat caacaccaaa tccggcacca aatgaatacc
     3721 aactacccac cgccaccagg ctacaatcat catggccatt aa
//