Dbfetch

LOCUS       NM_001312961            3681 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Prion-like-(Q/N-rich)-domain-bearing protein
            (pqn-80), partial mRNA.
ACCESSION   NM_001312961
VERSION     NM_001312961.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3681)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3681)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3681)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3681)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3681
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>3681
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /db_xref="GeneID:176683"
                     /db_xref="WormBase:WBGene00004161"
     CDS             1..3681
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /standard_name="Y111B2A.14f"
                     /note="Product from WormBase gene class pqn;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Prion-like-(Q/N-rich)-domain-bearing protein"
                     /protein_id="NP_001299890.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004161"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14f.1"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14f.2"
                     /db_xref="GeneID:176683"
                     /db_xref="UniProtKB/TrEMBL:A0A0K3ARB4"
                     /db_xref="WormBase:WBGene00004161"
                     /translation="MTGAPPSIRMVSSSSSLKKLPAPRKPSPPPAVEPTRSVEIIEKP
                     EKTEKPAEKRKTAATTSALEPAEKKKKPDSSSSSEEIILIDDNAPAAKKQPESAQKGS
                     TTVTMSAKKICKQQEEIAKQKPSSSSVTPSKPAAPTASTPKKEEIGTLETFLKNIFAN
                     LDAKGKLYQEKKLKTFDTETLKEITTFIDVMKHHKTEKVNMEPLIYSLAKSFGMTTQE
                     VMKQVEQEISSKKATTPKPSTNAVLSTISSQKSLEKNAADWKLTQTDLPTMGEKDIQM
                     LTTIVRSWKSKKEISNSMVTGWLKDVNQLKMNADQARKKFFDIINTLPDSSEKNGGGG
                     QQDANDIPKHERSRKARMFLHQWVYLSRKFLELQLPKLKHHSPPVEGLAKKQVIAANA
                     IKEGVRKQISLFENKKETSSRLPGDPVYVFQFTEPVLTAVAPYLEDLVDYALAAKKIE
                     LIVSGIDALHQSTDGKITIIQFYIEICRRLQKLSFLAVEEPMKSRLKEANEQIMKHQV
                     VQIPKYQLKWPDGQAEPSLKGLNRELYEFDKSILSMVAAKPSAPATPKASSSTALRPS
                     TSSTPSQQQSTSTAKAMTSSSTSAEDAKRLLAMNQLVQVYAGKYLLPTGNSTADICDP
                     TICLMNDDILLIMVTAVYSCGIPLVNQMNMLKNVLCQVGQTRMAQTLATQKTQNKQCL
                     TQNDYQLLFDYFGKFEKALEQRKAKKEEAERLKKLEEKLKKEKEKQAEKDRIEAKKFE
                     ERMKKEQEKQEEKERKEREKREEKERKEREIREIMERKKREEDDRIAAKLQIAQQLEN
                     DRKMREAEESARKETERRAKMETERKVAEARRAVERENQIKMMRAQQLQRRQEEAPPP
                     QQAPAPHTQKIQVKNEPVDHSFDILKEAEKDAHIIPTKSIKAEPLDVQKPLSAFEKLA
                     SLRGRTQSADMRRGGDSTEMPNVTQQYQAEQNHLAQSSNNSQYNAPSTSSQPQHFPTE
                     PSIRQPPPQQSYNSNQMLQNPRQQPQNQIVQNFQSAPQRHPHQNPQIATSSSSGGVNQ
                     FYNNGGAAPPVVEQQAANRRSSFTMSHSVQQHQSPLQQQFPINSYQSPSHHNNSSSMS
                     NSSLMQTPHSNSSMIARSPQFPSHTSPMSQRFHTPPSVGHQMVQSPLSQPNPSPLQHF
                     NFSPHSSSFSSQRPQMPPQRQMSQQNLMHQQQQPQNHTQHQYQHQTFSSQQQQLQQHQ
                     HQIRHQMNTNYPPPPGYNHHGH"
ORIGIN      
        1 atgacaggag ctccaccgtc aattcgaatg gtttcttctt cttcttcttt gaagaagctt
       61 ccggcccctc gaaaaccatc cccgccgccg gctgtagagc ccacaagatc tgtggaaatt
      121 attgagaagc ctgaaaagac tgaaaagccc gccgaaaagc gaaaaaccgc ggccaccaca
      181 tccgcactgg agcctgctga aaagaagaaa aagccggata gtagtagtag ttcggaggag
      241 ataattctta ttgatgataa tgctccggct gcaaagaagc agccggaaag tgctcaaaaa
      301 gggtccacca cagtcaccat gtcagccaag aaaatctgca aacaacagga agaaatcgct
      361 aagcagaagc cgtcatcatc atctgtaact ccatcaaaac cagctgctcc aacagcttca
      421 acaccgaaaa aagaggaaat cgggactctt gagacgttcc tgaagaatat atttgcaaat
      481 ttagatgcaa aagggaaact ttatcaggag aaaaagttga aaactttcga tacggagact
      541 ttaaaggaga taacaacgtt tatagatgta atgaagcatc ataaaactga aaaagttaat
      601 atggaaccgt tgatttattc gttggcgaaa tcatttggaa tgactacgca agaagttatg
      661 aaacaggtcg aacaagaaat ttcgtcgaaa aaggcaacaa ctccaaaacc ttcaacaaat
      721 gcagttttat cgacaatttc atctcaaaaa tcattggaaa aaaatgcagc cgattggaaa
      781 ttaacacaaa cggatttacc cacaatggga gaaaaagata tacaaatgtt gacgacaatt
      841 gttcgatcat ggaaaagtaa aaaagaaata tcgaattcaa tggtgactgg atggctgaaa
      901 gatgtgaatc aattgaaaat gaacgcagat caagcgagga aaaaattctt cgacatcata
      961 aatactttgc cggattcgtc tgaaaaaaat ggtggtggtg gacagcaaga tgccaacgat
     1021 attccaaaac acgaacgatc acgtaaagct cgaatgtttc tccaccaatg ggtctattta
     1081 tctcgtaaat ttttggagct tcaacttcca aaattgaaac atcattctcc acctgtcgaa
     1141 ggtctcgcaa agaagcaagt tatcgctgca aatgcaataa aagaaggtgt taggaagcaa
     1201 atttcacttt ttgaaaataa gaaagaaact tccagtcgtc tgcccggtga tcctgtctac
     1261 gtattccagt ttacggagcc tgttttaacc gcagtcgccc catacttgga agatctcgtc
     1321 gattatgcgc tcgcggcgaa aaaaatcgag ttaattgtat ccggaatcga cgctctacac
     1381 caatcaactg acggaaaaat taccataatt caattttata ttgaaatctg ccgaagactt
     1441 cagaaattat catttctcgc cgttgaagaa ccaatgaaaa gtcgtctgaa agaagcaaat
     1501 gaacaaatta tgaagcatca agttgttcaa attccaaaat atcaattgaa atggcctgat
     1561 ggacaggcgg agccatctct gaaagggctt aatcgagagc tttatgaatt cgacaaatca
     1621 attctctcca tggtggcggc taaaccatca gctcctgcaa ctccaaaagc ttcatcatct
     1681 acagccctcc gcccttctac gtcatcaact ccatctcagc agcaatccac gtcaactgca
     1741 aaagctatga cgtcatcatc aacatcagca gaagatgcga agcgcttact cgcaatgaat
     1801 caacttgttc aggtttacgc gggaaaatat ctgctcccga ccggcaattc aacggcagac
     1861 atttgtgatc caacaatttg tctaatgaat gatgatattc tactgattat ggtaacagct
     1921 gtctattcgt gtggtatacc attggttaat caaatgaata tgcttaaaaa tgtcctatgc
     1981 caagttggtc aaacccgaat ggctcagaca ttggcaacac aaaaaactca aaataagcag
     2041 tgcctgaccc aaaatgacta tcaactactt tttgattatt ttggaaagtt tgaaaaagca
     2101 ttagaacaac gaaaagcaaa aaaagaagaa gctgaaagat tgaagaaatt ggaggaaaaa
     2161 ttgaaaaaag agaaggagaa acaagcagag aaagatagaa ttgaggcgaa gaaattcgaa
     2221 gagcggatga aaaaagagca agaaaaacag gaagaaaaag agagaaaaga acgggaaaaa
     2281 cgagaggaaa aggaaaggaa agagagagaa attcgagaaa ttatggagag gaaaaagaga
     2341 gaagaagacg atcgaattgc tgcgaaatta caaattgctc aacaattaga gaatgacagg
     2401 aaaatgagag aagctgaaga aagtgcacgg aaggagacgg aacggagggc taaaatggaa
     2461 actgaacgaa aagtggcgga agctcggcga gcagttgaac gtgagaatca gatcaaaatg
     2521 atgagggctc aacagctgca aagacggcag gaagaggctc cgccccctca acaagctcca
     2581 gctccacata cacaaaagat tcaagtgaaa aatgagccag tagatcattc attcgatatt
     2641 ctaaaagaag cagaaaaaga tgcacacata attccaacaa aatcaataaa agccgagccg
     2701 ctggacgttc aaaaaccgct tagcgcattt gaaaagcttg catcacttcg tggtaggacc
     2761 caatctgctg atatgagaag aggcggggac tctacggaaa tgccgaatgt gacacaacaa
     2821 tatcaagcgg agcaaaatca tctagcacaa agttcgaata attctcagta caatgcacca
     2881 agtacaagtt cccagccaca acatttccca acagagcctt caatacgcca accacctccc
     2941 caacagagtt acaattccaa ccaaatgctc caaaatccac gacagcaacc ccaaaaccaa
     3001 attgtgcaaa atttccaaag tgctccgcaa cgacatcccc atcaaaatcc gcaaattgcc
     3061 acgtcatctt catctggagg agtcaatcag ttttataata atggtggagc tgcaccgcca
     3121 gttgtcgaac aacaagccgc taatagaaga tcatcattca caatgtctca ttcagttcaa
     3181 caacaccaat ctcctctcca acaacaattt ccaatcaatt catatcaatc accgagtcat
     3241 cataataata gtagctcaat gagcaattcc tcattaatgc aaacaccaca cagtaatagt
     3301 tcaatgattg cacggagtcc acaatttcca tctcatacgt ccccaatgtc ccaacgattc
     3361 cataccccac catcagttgg gcatcaaatg gtgcagagcc cattgtctca accgaatcct
     3421 tcgcctcttc aacatttcaa cttttcgcca cattcctcca gtttttcatc acaaagacct
     3481 caaatgccgc cacaacgtca aatgagccaa caaaatctca tgcatcaaca gcaacaacca
     3541 caaaatcata ctcaacatca gtaccaacat cagacattca gttctcagca acaacagctt
     3601 caacaacatc aacaccaaat ccggcaccaa atgaatacca actacccacc gccaccaggc
     3661 tacaatcatc atggccatta a
//