Dbfetch

LOCUS       NM_001312960            3771 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Prion-like-(Q/N-rich)-domain-bearing protein
            (pqn-80), partial mRNA.
ACCESSION   NM_001312960
VERSION     NM_001312960.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3771)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3771)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3771)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3771)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3771
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>3771
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /db_xref="GeneID:176683"
                     /db_xref="WormBase:WBGene00004161"
     CDS             1..3771
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /standard_name="Y111B2A.14e"
                     /note="Product from WormBase gene class pqn;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Prion-like-(Q/N-rich)-domain-bearing protein"
                     /protein_id="NP_001299889.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004161"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14e.1"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14e.2"
                     /db_xref="GeneID:176683"
                     /db_xref="UniProtKB/TrEMBL:A0A0K3AU63"
                     /db_xref="WormBase:WBGene00004161"
                     /translation="MTGAPPSIRMVSSSSSLKKLPAPRKPSPPPAVEPTRSVEIIEKP
                     EKTEKPAEKRKTAATTSALEPAEKKKKPDSSSSSEEIILIDDNAPAAKKQPESAQKGS
                     TTVTMSAKKICKQQEEIAKQKPSSSSVTPSKPAAPTASTPKKEEIGTLETFLKNIFAN
                     LDAKGKLYQEKKLKTFDTETLKEITTFIDVMKHHKTEKVNMEPLIYSLAKSFGMTTQE
                     VMKQVEQEISSKKATTPKPSTNAVLSTISSQKSLEKNAADWKLTQTDLPTMGEKDIQM
                     LTTIVRSWKSKKEISNSMVTGWLKDVNQLKMNADQARKKFFDIINTLPDSSEKNGGGG
                     QQDANDIPKHERSRKARMFLHQWVYLSRKFLELQLPKLKHHSPPVEGLAKKQVIAANA
                     IKEGVRKQISLFENKKETSSRLPGDPVYVFQFTEPVLTAVAPYLEDLVDYALAAKKIE
                     LIVSGIDALHQSTDGKITIIQFYIEICRRLQKLSFLAVEEPMKSRLKEANEQIMKHQV
                     VQIPKYQLKWPDGQAEPSLKGLNRELYEFDKSILSMVAAKPSAPATPKASSSTALRPS
                     TSSTPSQQQSTSTAKAMTSSSTSAEDAKRLLAMNQLVQVYAGKYLLPTGNSTADICDP
                     TICLMNDDILLIMVTAVYSCGIPLVNQMNMLKNVLCQVGQTRMAQTLATQKTQNKQCL
                     TQNDYQLLFDYFGKFEKALEQRKAKKEEAERLKKLEEKLKKEKEKQAEKDRIEAKKFE
                     ERMKKEQEKQEEKERKEREKREEKERKEREIREIMERKKREEDDRIAAKLQIAQQLEN
                     DRKMREAEESARKETERRAKMETEAANALQGLEEDLLMDDIDFMTQQQTKVDEERKVA
                     EARRAVERENQIKMMRAQQLQRRQEEAPPPQQAPAPHTQKIQVKNEPVDHSFDILKEA
                     EKDAHIIPTKSIKAEPLDVQKPLSAFEKLASLRGRTQSADMRRGGDSTEMPNVTQQYQ
                     AEQNHLAQSSNNSQYNAPSTSSQPQHFPTEPSIRQPPPQQSYNSNQMLQNPRQQPQNQ
                     IVQNFQSAPQRHPHQNPQIATSSSSGGVNQFYNNGGAAPPVVEQQAANRRSSFTMSHS
                     VQQHQSPLQQQFPINSYQSPSHHNNSSSMSNSSLMQTPHSNSSMIARSPQFPSHTSPM
                     SQRFHTPPSVGHQMVQSPLSQPNPSPLQHFNFSPHSSSFSSQRPQMPPQRQMSQQNLM
                     HQQQQPQNHTQHQYQHQTFSSQQQQLQQHQHQIRHQMNTNYPPPPGYNHHGH"
ORIGIN      
        1 atgacaggag ctccaccgtc aattcgaatg gtttcttctt cttcttcttt gaagaagctt
       61 ccggcccctc gaaaaccatc cccgccgccg gctgtagagc ccacaagatc tgtggaaatt
      121 attgagaagc ctgaaaagac tgaaaagccc gccgaaaagc gaaaaaccgc ggccaccaca
      181 tccgcactgg agcctgctga aaagaagaaa aagccggata gtagtagtag ttcggaggag
      241 ataattctta ttgatgataa tgctccggct gcaaagaagc agccggaaag tgctcaaaaa
      301 gggtccacca cagtcaccat gtcagccaag aaaatctgca aacaacagga agaaatcgct
      361 aagcagaagc cgtcatcatc atctgtaact ccatcaaaac cagctgctcc aacagcttca
      421 acaccgaaaa aagaggaaat cgggactctt gagacgttcc tgaagaatat atttgcaaat
      481 ttagatgcaa aagggaaact ttatcaggag aaaaagttga aaactttcga tacggagact
      541 ttaaaggaga taacaacgtt tatagatgta atgaagcatc ataaaactga aaaagttaat
      601 atggaaccgt tgatttattc gttggcgaaa tcatttggaa tgactacgca agaagttatg
      661 aaacaggtcg aacaagaaat ttcgtcgaaa aaggcaacaa ctccaaaacc ttcaacaaat
      721 gcagttttat cgacaatttc atctcaaaaa tcattggaaa aaaatgcagc cgattggaaa
      781 ttaacacaaa cggatttacc cacaatggga gaaaaagata tacaaatgtt gacgacaatt
      841 gttcgatcat ggaaaagtaa aaaagaaata tcgaattcaa tggtgactgg atggctgaaa
      901 gatgtgaatc aattgaaaat gaacgcagat caagcgagga aaaaattctt cgacatcata
      961 aatactttgc cggattcgtc tgaaaaaaat ggtggtggtg gacagcaaga tgccaacgat
     1021 attccaaaac acgaacgatc acgtaaagct cgaatgtttc tccaccaatg ggtctattta
     1081 tctcgtaaat ttttggagct tcaacttcca aaattgaaac atcattctcc acctgtcgaa
     1141 ggtctcgcaa agaagcaagt tatcgctgca aatgcaataa aagaaggtgt taggaagcaa
     1201 atttcacttt ttgaaaataa gaaagaaact tccagtcgtc tgcccggtga tcctgtctac
     1261 gtattccagt ttacggagcc tgttttaacc gcagtcgccc catacttgga agatctcgtc
     1321 gattatgcgc tcgcggcgaa aaaaatcgag ttaattgtat ccggaatcga cgctctacac
     1381 caatcaactg acggaaaaat taccataatt caattttata ttgaaatctg ccgaagactt
     1441 cagaaattat catttctcgc cgttgaagaa ccaatgaaaa gtcgtctgaa agaagcaaat
     1501 gaacaaatta tgaagcatca agttgttcaa attccaaaat atcaattgaa atggcctgat
     1561 ggacaggcgg agccatctct gaaagggctt aatcgagagc tttatgaatt cgacaaatca
     1621 attctctcca tggtggcggc taaaccatca gctcctgcaa ctccaaaagc ttcatcatct
     1681 acagccctcc gcccttctac gtcatcaact ccatctcagc agcaatccac gtcaactgca
     1741 aaagctatga cgtcatcatc aacatcagca gaagatgcga agcgcttact cgcaatgaat
     1801 caacttgttc aggtttacgc gggaaaatat ctgctcccga ccggcaattc aacggcagac
     1861 atttgtgatc caacaatttg tctaatgaat gatgatattc tactgattat ggtaacagct
     1921 gtctattcgt gtggtatacc attggttaat caaatgaata tgcttaaaaa tgtcctatgc
     1981 caagttggtc aaacccgaat ggctcagaca ttggcaacac aaaaaactca aaataagcag
     2041 tgcctgaccc aaaatgacta tcaactactt tttgattatt ttggaaagtt tgaaaaagca
     2101 ttagaacaac gaaaagcaaa aaaagaagaa gctgaaagat tgaagaaatt ggaggaaaaa
     2161 ttgaaaaaag agaaggagaa acaagcagag aaagatagaa ttgaggcgaa gaaattcgaa
     2221 gagcggatga aaaaagagca agaaaaacag gaagaaaaag agagaaaaga acgggaaaaa
     2281 cgagaggaaa aggaaaggaa agagagagaa attcgagaaa ttatggagag gaaaaagaga
     2341 gaagaagacg atcgaattgc tgcgaaatta caaattgctc aacaattaga gaatgacagg
     2401 aaaatgagag aagctgaaga aagtgcacgg aaggagacgg aacggagggc taaaatggaa
     2461 actgaagcag caaatgcact acaaggactc gaagaggacc ttctcatgga tgatatcgat
     2521 tttatgactc aacaacaaac aaaagtcgat gaggaacgaa aagtggcgga agctcggcga
     2581 gcagttgaac gtgagaatca gatcaaaatg atgagggctc aacagctgca aagacggcag
     2641 gaagaggctc cgccccctca acaagctcca gctccacata cacaaaagat tcaagtgaaa
     2701 aatgagccag tagatcattc attcgatatt ctaaaagaag cagaaaaaga tgcacacata
     2761 attccaacaa aatcaataaa agccgagccg ctggacgttc aaaaaccgct tagcgcattt
     2821 gaaaagcttg catcacttcg tggtaggacc caatctgctg atatgagaag aggcggggac
     2881 tctacggaaa tgccgaatgt gacacaacaa tatcaagcgg agcaaaatca tctagcacaa
     2941 agttcgaata attctcagta caatgcacca agtacaagtt cccagccaca acatttccca
     3001 acagagcctt caatacgcca accacctccc caacagagtt acaattccaa ccaaatgctc
     3061 caaaatccac gacagcaacc ccaaaaccaa attgtgcaaa atttccaaag tgctccgcaa
     3121 cgacatcccc atcaaaatcc gcaaattgcc acgtcatctt catctggagg agtcaatcag
     3181 ttttataata atggtggagc tgcaccgcca gttgtcgaac aacaagccgc taatagaaga
     3241 tcatcattca caatgtctca ttcagttcaa caacaccaat ctcctctcca acaacaattt
     3301 ccaatcaatt catatcaatc accgagtcat cataataata gtagctcaat gagcaattcc
     3361 tcattaatgc aaacaccaca cagtaatagt tcaatgattg cacggagtcc acaatttcca
     3421 tctcatacgt ccccaatgtc ccaacgattc cataccccac catcagttgg gcatcaaatg
     3481 gtgcagagcc cattgtctca accgaatcct tcgcctcttc aacatttcaa cttttcgcca
     3541 cattcctcca gtttttcatc acaaagacct caaatgccgc cacaacgtca aatgagccaa
     3601 caaaatctca tgcatcaaca gcaacaacca caaaatcata ctcaacatca gtaccaacat
     3661 cagacattca gttctcagca acaacagctt caacaacatc aacaccaaat ccggcaccaa
     3721 atgaatacca actacccacc gccaccaggc tacaatcatc atggccatta a
//