Dbfetch

LOCUS       NM_001312959            4260 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Prion-like-(Q/N-rich)-domain-bearing protein
            (pqn-80), partial mRNA.
ACCESSION   NM_001312959
VERSION     NM_001312959.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 4260)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 4260)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 4260)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 4260)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..4260
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>4260
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /db_xref="GeneID:176683"
                     /db_xref="WormBase:WBGene00004161"
     CDS             1..4260
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /standard_name="Y111B2A.14d"
                     /note="Product from WormBase gene class pqn;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Prion-like-(Q/N-rich)-domain-bearing protein"
                     /protein_id="NP_001299888.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004161"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14d.1"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14d.2"
                     /db_xref="GeneID:176683"
                     /db_xref="InterPro:IPR014840"
                     /db_xref="UniProtKB/TrEMBL:A0A0K3ARW1"
                     /db_xref="WormBase:WBGene00004161"
                     /translation="MDSLGSSKKKKKAEKSAKNEVIQIRISVAKPGSKKYTHVDWEEL
                     LKNNGKERDEDDLRRFYDEDTLFMAKKLGETRSKSGKKLRVNLDQLQHFNRKCGYDMD
                     DDFIDDTEIVDDEPTTSKKGGFYVGKGDVKDSNDEDEEEEEETDVEESIQEVPKKVKI
                     RKIKEKSGEKSSKSSDSSSSSSSDSEDAAGPPRMTGAPPSIRMVSSSSSLKKLPAPRK
                     PSPPPAVEPTRSVEIIEKPEKTEKPAEKRKTAATTSALEPAEKKKKPDSSSSSEEIIL
                     IDDNAPAAKKQPESAQKGSTTVTMSAKKICKQQEEIAKQKPSSSSVTPSKPAAPTAST
                     PKKEEIGTLETFLKNIFANLDAKGKLYQEKKLKTFDTETLKEITTFIDVMKHHKTEKV
                     NMEPLIYSLAKSFGMTTQEVMKQVEQEISSKKATTPKPSTNAVLSTISSQKSLEKNAA
                     DWKLTQTDLPTMGEKDIQMLTTIVRSWKSKKEISNSMVTGWLKDVNQLKMNADQARKK
                     FFDIINTLPDSSEKNGGGGQQDANDIPKHERSRKARMFLHQWVYLSRKFLELQLPKLK
                     HHSPPVEGLAKKQVIAANAIKEGVRKQISLFENKKETSSRLPGDPVYVFQFTEPVLTA
                     VAPYLEDLVDYALAAKKIELIVSGIDALHQSTDGKITIIQFYIEICRRLQKLSFLAVE
                     EPMKSRLKEANEQIMKHQVVQIPKYQLKWPDGQAEPSLKGLNRELYEFDKSILSMVAA
                     KPSAPATPKASSSTALRPSTSSTPSQQQSTSTAKAMTSSSTSAEDAKRLLAMNQLVQV
                     YAGKYLLPTGNSTADICDPTICLMNDDILLIMVTAVYSCGIPLVNQMNMLKNVLCQVG
                     QTRMAQTLATQKTQNKQCLTQNDYQLLFDYFGKFEKALEQRKAKKEEAERLKKLEEKL
                     KKEKEKQAEKDRIEAKKFEERMKKEQEKQEEKERKEREKREEKERKEREIREIMERKK
                     REEDDRIAAKLQIAQQLENDRKMREAEESARKETERRAKMETERKVAEARRAVERENQ
                     IKMMRAQQLQRRQEEAPPPQQAPAPHTQKIQVKNEPVDHSFDILKEAEKDAHIIPTKS
                     IKAEPLDVQKPLSAFEKLASLRGRTQSADMRRGGDSTEMPNVTQQYQAEQNHLAQSSN
                     NSQYNAPSTSSQPQHFPTEPSIRQPPPQQSYNSNQMLQNPRQQPQNQIVQNFQSAPQR
                     HPHQNPQIATSSSSGGVNQFYNNGGAAPPVVEQQAANRRSSFTMSHSVQQHQSPLQQQ
                     FPINSYQSPSHHNNSSSMSNSSLMQTPHSNSSMIARSPQFPSHTSPMSQRFHTPPSVG
                     HQMVQSPLSQPNPSPLQHFNFSPHSSSFSSQRPQMPPQRQMSQQNLMHQQQQPQNHTQ
                     HQYQHQTFSSQQQQLQQHQHQIRHQMNTNYPPPPGYNHHGH"
ORIGIN      
        1 atggactcat tgggtagctc aaagaagaag aaaaaagccg aaaagagcgc gaaaaacgag
       61 gttattcaaa ttcgcatcag tgtcgcgaag ccgggcagca agaaatacac tcatgtcgat
      121 tgggaggaac tgctgaagaa taatggaaaa gagcgggacg aagatgatct ccgcagattt
      181 tacgatgaag acacactttt tatggcaaaa aagctcgggg agacgagaag caaaagtgga
      241 aagaaacttc gcgttaattt ggaccagctg caacatttca accgaaagtg tggatatgat
      301 atggatgatg actttattga tgacacagaa atagttgacg acgagcctac aacatcgaaa
      361 aagggtggat tttatgtggg aaagggtgat gtgaaggatt caaacgacga ggatgaggaa
      421 gaagaagaag aaaccgatgt ggaagaatcg attcaggaag ttccgaagaa ggtgaaaatc
      481 aggaaaatca aagagaaatc tggcgaaaaa tccagtaaat ccagtgattc ttcatcatcc
      541 tcctcgtccg attcggagga tgctgctggg cctccgagaa tgacaggagc tccaccgtca
      601 attcgaatgg tttcttcttc ttcttctttg aagaagcttc cggcccctcg aaaaccatcc
      661 ccgccgccgg ctgtagagcc cacaagatct gtggaaatta ttgagaagcc tgaaaagact
      721 gaaaagcccg ccgaaaagcg aaaaaccgcg gccaccacat ccgcactgga gcctgctgaa
      781 aagaagaaaa agccggatag tagtagtagt tcggaggaga taattcttat tgatgataat
      841 gctccggctg caaagaagca gccggaaagt gctcaaaaag ggtccaccac agtcaccatg
      901 tcagccaaga aaatctgcaa acaacaggaa gaaatcgcta agcagaagcc gtcatcatca
      961 tctgtaactc catcaaaacc agctgctcca acagcttcaa caccgaaaaa agaggaaatc
     1021 gggactcttg agacgttcct gaagaatata tttgcaaatt tagatgcaaa agggaaactt
     1081 tatcaggaga aaaagttgaa aactttcgat acggagactt taaaggagat aacaacgttt
     1141 atagatgtaa tgaagcatca taaaactgaa aaagttaata tggaaccgtt gatttattcg
     1201 ttggcgaaat catttggaat gactacgcaa gaagttatga aacaggtcga acaagaaatt
     1261 tcgtcgaaaa aggcaacaac tccaaaacct tcaacaaatg cagttttatc gacaatttca
     1321 tctcaaaaat cattggaaaa aaatgcagcc gattggaaat taacacaaac ggatttaccc
     1381 acaatgggag aaaaagatat acaaatgttg acgacaattg ttcgatcatg gaaaagtaaa
     1441 aaagaaatat cgaattcaat ggtgactgga tggctgaaag atgtgaatca attgaaaatg
     1501 aacgcagatc aagcgaggaa aaaattcttc gacatcataa atactttgcc ggattcgtct
     1561 gaaaaaaatg gtggtggtgg acagcaagat gccaacgata ttccaaaaca cgaacgatca
     1621 cgtaaagctc gaatgtttct ccaccaatgg gtctatttat ctcgtaaatt tttggagctt
     1681 caacttccaa aattgaaaca tcattctcca cctgtcgaag gtctcgcaaa gaagcaagtt
     1741 atcgctgcaa atgcaataaa agaaggtgtt aggaagcaaa tttcactttt tgaaaataag
     1801 aaagaaactt ccagtcgtct gcccggtgat cctgtctacg tattccagtt tacggagcct
     1861 gttttaaccg cagtcgcccc atacttggaa gatctcgtcg attatgcgct cgcggcgaaa
     1921 aaaatcgagt taattgtatc cggaatcgac gctctacacc aatcaactga cggaaaaatt
     1981 accataattc aattttatat tgaaatctgc cgaagacttc agaaattatc atttctcgcc
     2041 gttgaagaac caatgaaaag tcgtctgaaa gaagcaaatg aacaaattat gaagcatcaa
     2101 gttgttcaaa ttccaaaata tcaattgaaa tggcctgatg gacaggcgga gccatctctg
     2161 aaagggctta atcgagagct ttatgaattc gacaaatcaa ttctctccat ggtggcggct
     2221 aaaccatcag ctcctgcaac tccaaaagct tcatcatcta cagccctccg cccttctacg
     2281 tcatcaactc catctcagca gcaatccacg tcaactgcaa aagctatgac gtcatcatca
     2341 acatcagcag aagatgcgaa gcgcttactc gcaatgaatc aacttgttca ggtttacgcg
     2401 ggaaaatatc tgctcccgac cggcaattca acggcagaca tttgtgatcc aacaatttgt
     2461 ctaatgaatg atgatattct actgattatg gtaacagctg tctattcgtg tggtatacca
     2521 ttggttaatc aaatgaatat gcttaaaaat gtcctatgcc aagttggtca aacccgaatg
     2581 gctcagacat tggcaacaca aaaaactcaa aataagcagt gcctgaccca aaatgactat
     2641 caactacttt ttgattattt tggaaagttt gaaaaagcat tagaacaacg aaaagcaaaa
     2701 aaagaagaag ctgaaagatt gaagaaattg gaggaaaaat tgaaaaaaga gaaggagaaa
     2761 caagcagaga aagatagaat tgaggcgaag aaattcgaag agcggatgaa aaaagagcaa
     2821 gaaaaacagg aagaaaaaga gagaaaagaa cgggaaaaac gagaggaaaa ggaaaggaaa
     2881 gagagagaaa ttcgagaaat tatggagagg aaaaagagag aagaagacga tcgaattgct
     2941 gcgaaattac aaattgctca acaattagag aatgacagga aaatgagaga agctgaagaa
     3001 agtgcacgga aggagacgga acggagggct aaaatggaaa ctgaacgaaa agtggcggaa
     3061 gctcggcgag cagttgaacg tgagaatcag atcaaaatga tgagggctca acagctgcaa
     3121 agacggcagg aagaggctcc gccccctcaa caagctccag ctccacatac acaaaagatt
     3181 caagtgaaaa atgagccagt agatcattca ttcgatattc taaaagaagc agaaaaagat
     3241 gcacacataa ttccaacaaa atcaataaaa gccgagccgc tggacgttca aaaaccgctt
     3301 agcgcatttg aaaagcttgc atcacttcgt ggtaggaccc aatctgctga tatgagaaga
     3361 ggcggggact ctacggaaat gccgaatgtg acacaacaat atcaagcgga gcaaaatcat
     3421 ctagcacaaa gttcgaataa ttctcagtac aatgcaccaa gtacaagttc ccagccacaa
     3481 catttcccaa cagagccttc aatacgccaa ccacctcccc aacagagtta caattccaac
     3541 caaatgctcc aaaatccacg acagcaaccc caaaaccaaa ttgtgcaaaa tttccaaagt
     3601 gctccgcaac gacatcccca tcaaaatccg caaattgcca cgtcatcttc atctggagga
     3661 gtcaatcagt tttataataa tggtggagct gcaccgccag ttgtcgaaca acaagccgct
     3721 aatagaagat catcattcac aatgtctcat tcagttcaac aacaccaatc tcctctccaa
     3781 caacaatttc caatcaattc atatcaatca ccgagtcatc ataataatag tagctcaatg
     3841 agcaattcct cattaatgca aacaccacac agtaatagtt caatgattgc acggagtcca
     3901 caatttccat ctcatacgtc cccaatgtcc caacgattcc ataccccacc atcagttggg
     3961 catcaaatgg tgcagagccc attgtctcaa ccgaatcctt cgcctcttca acatttcaac
     4021 ttttcgccac attcctccag tttttcatca caaagacctc aaatgccgcc acaacgtcaa
     4081 atgagccaac aaaatctcat gcatcaacag caacaaccac aaaatcatac tcaacatcag
     4141 taccaacatc agacattcag ttctcagcaa caacagcttc aacaacatca acaccaaatc
     4201 cggcaccaaa tgaataccaa ctacccaccg ccaccaggct acaatcatca tggccattaa
//