Dbfetch

LOCUS       NM_001312927            2229 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Armadillo repeat-containing protein wrm-1
            (wrm-1), partial mRNA.
ACCESSION   NM_001312927
VERSION     NM_001312927.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 2229)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 2229)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2229)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 2229)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..2229
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>2229
                     /gene="wrm-1"
                     /locus_tag="CELE_B0336.1"
                     /db_xref="GeneID:175802"
                     /db_xref="WormBase:WBGene00006943"
     CDS             1..2229
                     /gene="wrm-1"
                     /locus_tag="CELE_B0336.1"
                     /standard_name="B0336.1b"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Armadillo repeat-containing protein wrm-1"
                     /protein_id="NP_001299856.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006943"
                     /db_xref="EnsemblGenomes-Tr:B0336.1b"
                     /db_xref="GeneID:175802"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:A0A0K3AUT2"
                     /db_xref="WormBase:WBGene00006943"
                     /translation="MEPSNSRVQELREAAVGKRSYTNAWMQGTYAPPQMAGQQQRFSR
                     PPSVIGSTMSHMTNMSEMTAYSYGGLSMLSVNTEMGEFNNFVNQAPYQRALTRVSQVS
                     ENQDPTNRQYPMTAPEIIENLESTELINQAAAIRALEPIVKAGGMLQTWGPKGAEPII
                     RALFQVLIPRPVENENVIRKAFEILHHSILLSNKEIRRIDRMFFRLNAALMDPNGPPV
                     FNVPKPYSIYEIVMTRAIQLDTKFESSAMVLLVHLCCKPHFMKIFFGEDETQQSPAHR
                     RLHKIVIEFAIGNLRRPETKSKNKGLCVSIIKNLSNKNATIKDMSERLGVVSLFHQIM
                     QNEVIHEDLLWSTMQALTVFCGDVKNGTHFVQMGGAQVLCGLLSHGSTRLLHELLKCL
                     RRVSDLPAIQEQDMKESIHCIVQLIGCSDVTIVELATGTLRNIGLHNKMNKAFMVQDG
                     VTSHAIAVLRTSEQFTYQPHANIDLYRKQILSIYENCLSVLNNVTSMAPQDIKESAVS
                     ACRMISENADSAYVLLHYFNVGNRKCRKLAVTVMKRVIETVPAFADPFVDLLGTTNEP
                     LPILLLQRAFQSLDEWRKTSVEMMNCDGRSAEQRRELDDRRKDHEDIVKRSVGLLTNL
                     CSQANPRFFHSLKLVLTNGTLNPFQWLTHEMSDGILQEWLAFILSICSRDESLQTFMM
                     YRFLEQAKMTEAFFAELKARRQNSNIQTMLSKIIDLGRHQQRIVSQQHQQHQMQHHRQ
                     LM"
     STS             105..1027
                     /gene="wrm-1"
                     /locus_tag="CELE_B0336.1"
                     /standard_name="B0336.1"
                     /db_xref="UniSTS:308847"
ORIGIN      
        1 atggaaccgt ccaattctcg ggtgcaagaa ctccgggaag ctgctgtggg aaagcgatca
       61 tacacaaatg cttggatgca gggtacctat gcaccgccgc agatggcagg acaacaacaa
      121 aggttttcga ggcctccgag tgtgatcggc tccacaatgt ctcacatgac gaatatgtca
      181 gaaatgaccg cctactcgta cggtggattg tcaatgctct cagtcaacac tgaaatgggt
      241 gaattcaaca attttgtcaa tcaggcacca tatcagcgag cactgacacg tgtatcgcag
      301 gtttccgaga atcaggatcc gacgaatcga cagtatccga tgacagctcc cgagattatt
      361 gagaatctgg aatcaacgga actaatcaat caagcagcag cgattcgagc tttggagcca
      421 attgtgaaag ctggtggaat gttgcaaacc tggggaccta aaggagccga accgattatt
      481 cgagctctgt ttcaagttct tattcctcgg ccagttgaga atgagaatgt aatccggaaa
      541 gcgtttgaaa ttctccacca ctcaattctt ctctccaaca aggaaatccg acgtatcgac
      601 aggatgttct tccgactgaa tgcggcatta atggatccca atgggccgcc tgtgttcaat
      661 gtaccaaagc catacagtat ctatgagatc gtgatgacac gtgccattca acttgacacg
      721 aaattcgagt ccagtgctat ggttctgctc gtacatcttt gttgtaaacc tcatttcatg
      781 aagattttct ttggagaaga tgagactcaa cagtcaccag cacatcgacg tcttcacaaa
      841 atagtaattg aatttgcaat tggaaacctg agaagaccgg aaacgaagtc aaagaataag
      901 ggactttgtg tatcgattat taagaatttg tcgaataaaa atgcaactat caaagatatg
      961 tcagaacgtc ttggtgttgt gagcctcttt catcaaatta tgcagaacga agtgatccac
     1021 gaggatttgt tgtggtcaac gatgcaggct cttaccgtat tctgtggaga tgttaagaat
     1081 ggaacacatt ttgtgcaaat gggtggagca caagttttgt gcggtcttct ttcgcatgga
     1141 tcaacacgac ttcttcacga acttctgaag tgtttgagac gagtatcaga tttgccagcg
     1201 atccaggagc aggatatgaa agaatcgatt cattgtatag ttcaacttat tggatgttcg
     1261 gatgtaacga ttgttgagct agcgactgga actctacgaa atattggact tcataacaag
     1321 atgaacaagg catttatggt gcaggatgga gttacaagtc atgcgatcgc agttcttcgg
     1381 acatctgaac agtttacata tcagccacat gccaatatag atttatatag aaagcagatt
     1441 ctgtcgattt atgaaaattg tctatccgta ttgaacaatg tgacttctat ggcacctcaa
     1501 gatatcaaag aatctgcagt atcagcgtgt agaatgatca gtgagaatgc cgactccgca
     1561 tatgtgctcc ttcattactt taacgttgga aatcggaagt gcaggaaact tgcggtgaca
     1621 gtaatgaaac gtgtcattga gacggttcct gcttttgctg atccgtttgt tgatctactt
     1681 ggaacaacaa atgagccact accaatttta ttgcttcaaa gagcattcca gagtttggac
     1741 gaatggcgga aaactagcgt tgaaatgatg aattgtgacg gtagaagtgc tgagcagaga
     1801 agagaattag atgacagacg aaaagatcac gaagatattg taaaacgatc tgtgggactt
     1861 ttaacgaatc tttgtagtca ggcaaatcca agatttttcc acagtttgaa gctagtattg
     1921 acaaatggca cgctaaaccc cttccaatgg ctgacacatg agatgagtga cggtattctg
     1981 caagagtggc tagcattcat tttgtcaatt tgtagtcgtg acgagtcact gcaaactttt
     2041 atgatgtaca gattcctgga acaggcaaaa atgactgaag cattctttgc ggaactcaag
     2101 gctcgtcggc agaattcgaa tattcaaact atgttgtcaa agatcatcga tcttggtaga
     2161 catcagcaga gaatagtttc acaacaacat caacagcatc aaatgcagca tcatcgacaa
     2221 ctaatgtga
//