Dbfetch

LOCUS       NM_001307737           14670 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans KETtiN (Drosophila actin-binding) homolog
            (ketn-1), partial mRNA.
ACCESSION   NM_001307737
VERSION     NM_001307737.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 14670)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 14670)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 14670)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 14670)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..14670
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            <1..>14670
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /db_xref="GeneID:178740"
                     /db_xref="WormBase:WBGene00004130"
     CDS             1..14670
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /standard_name="F54E2.3e"
                     /note="Product from WormBase gene class ketn;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="KETtiN (Drosophila actin-binding) homolog"
                     /protein_id="NP_001294666.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004130"
                     /db_xref="EnsemblGenomes-Tr:F54E2.3e"
                     /db_xref="GeneID:178740"
                     /db_xref="GOA:V6CLU0"
                     /db_xref="InterPro:IPR003598"
                     /db_xref="InterPro:IPR003599"
                     /db_xref="InterPro:IPR007110"
                     /db_xref="InterPro:IPR010939"
                     /db_xref="InterPro:IPR013098"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR036179"
                     /db_xref="UniProtKB/TrEMBL:V6CLU0"
                     /db_xref="WormBase:WBGene00004130"
                     /translation="MPFKQPLGERDAANRVAPTFIRPLADKRAVVGETIILECQLEGH
                     PDPAIKWLKDGHNVSMCPDYRIEEDGLKHRLVIPQVQAADSGRFTAQASNSAGTKQST
                     CILICAPAPTPVPGAKSAVASPAPPQTPVGPSAPIFLKELRHQPLKPGAGVTFEGRVI
                     AVPPPNIEWMKNGKPLQNYRAKIEHDQKTGIISLIIPQMFNDDAGEYTIKATNVHGEA
                     ISGAQLLPREQYDRWFSNEQTRLTKDRKQGLLSQTLRPSSVAQKQMQKQGYDTDQGSV
                     DMHWTISESETEPELSALDARGVGTKPIIRTPLRGLRLTEGTDAILQANIVGNPKPRI
                     QWLFNGRPLQVSGPRMQMTYKGSMAVLKISMVTTEEAGDYTVASENRFGKVESSARIE
                     VYPLSVPDERRKENQLREQQERDRQQQQQALVEASLARERQRDAENRRIREEQDRLRV
                     LFEREKAERERLEEERRQLEHEKRLRQQQQQQLFEREKSEKEERARLEEERRRLEHEK
                     HLRQQQQTQPYNLHYQQHHQPHQAWQDLDLVRRPQYASDEYQEPHYAQIRPHQQQQQH
                     YQQQQQSPRQEVTHQNLYEQHRRQQQLIREQQLYQHQHQQHQQQQQQPQEQQQQRFHH
                     FNQYQQHIREQHQNTMPVFRQQQPTQVTNGGIKAANGSAKTANGSANGSANGSAVHAA
                     NGGPSSQQARGHEHGAALVNARPPQFLVHPQSVAAKAFETVTFSAKVVGTPTPSLTWQ
                     KSDGTVIQSGGKYKIENGPDGSGRLIIEKVDAHDADMYMLVARNDGGSFQSRFSLNVL
                     QAKSPEAPEFTGKFQSTTLYDGDSVKLYCKAAGEGVSFKWFKDNEPISSGGSYAVDNK
                     GNETTLHINNATMKEGGWYRCDATNKHGTTTLKGRVVVNSRQKFNGPAHREMITLRKV
                     DKVERSRTPVNQLQDVSASKSSPKFEGSLQSQQLVEGQSARLEIKYTPVEDPNLRIAW
                     LLNGKGILASSRIVTFTDFGIAALEINPVNVFDQGEYTVVAVNPLGEARVSANIAVIG
                     HGSFIQQQQSGSQFGGTAYQSKGAQAPAGTHLDLPNFHSDLRSQEVFEGQQIHLETKL
                     TPINDPDLRVVWLLDGNELPSNDKYRQTLSHGFASLDIPQTSSNDSGLYSCRAFNKLG
                     ESENQATIIIVPKSDLQQFEQHRQLDVEDVREIQFAHSSQDLTPKFLSQIQPFHCEQE
                     LGRSFFEARIQPINDPTLRVSWLKDGQPLPNANRIQIFQNFGVVSLSLHPTYPEDAGV
                     YTCVLFNSHGQAQSSAELTTVWIDTLQLDSKHADSLPIIGYLDSHQIHIGPQSVERPE
                     EFNSLEAPKFARELAGKIEVMENERVHFEARILPANDVKMTVEWYHNGNPLPAAHRFH
                     PMFDFGYVALDLLYAYPQDSGTYTLVARNELGEARSNVELVVGTEKVLYLEPHHPEGL
                     ERIKELEQDRRQGIAEVEDRTCDAAPKFLNDLPDIQLNEHENIHVDLRATPVNDPTMV
                     IEWFVNGRPLLTGSRVKTLNEFGFIALDIKGAIAEDSGTYSVRASNLLGEAIRQCVIT
                     VTPAGQILSDTQHQESLGKINYLENLNKYGRVEIEDKGPQEPPTFVVPLQADLGDVEE
                     GEPIHLECQVNPINDNSLKIIWLRDGQSLPHGHRFRTFYDFGFVSLDILGFYAQDAGT
                     YTCRAENSLGQAETVATIRCAPKDAILGAVQHPRSYARIQEIEAPKPAPQEVPDLPHQ
                     PPAFVKQLGPAIQCMEGDNVYLEAQVTPTDDNSLTYEWLVNGQPLMKAHRFVLSQDFG
                     YIALNILYCYPEDNGTYTLVVRNRAGEAQSTVDINCGHTGGNFTDSFHPNSLHRIAEL
                     ETPIQRAEPLPDKEKEVPTIAKPLPATIDSVHESQTLHLEAQVTPIDDNTLRYEWLFN
                     GNPLKASSRYRVLNDFGFVSLDIDYIIAEDSGKYTLVVYNSAGRAETSCEFQVDRLKS
                     ILSDTAHPESLRRIREMEQLQPAKPSDDDAAAQPPVFTQQLTGPTEPLKEGQSVHMDC
                     VVQPINDPSLRIEWFHDGRPLMFGSRIRTIHDFGYVGLEFLHIHPEDTGTYTCKATNL
                     IGEATTDIFLECKPRRNIYLDTHHESSWQKIQEIENRVDEREPTPELTFQPPTFTENL
                     ADKEDAQEGQSIRLECRLIPVNDPTMRVTWTRNGQPLPEASRFMPARNFDYVNLDILA
                     LYGEDSGVYTCKAVSAFGEAATSCTVKCAAGKSLLLDTMHDASWKRVQEIENREKLEA
                     VDAEPEKTAPKFVTQLNSSLGELQEGVPIHLEAQVEPTNDNQLTVQWFHNGQPLANGH
                     RFRTRHDFGYVALDILYAFAQDTGEWACVARNSLGEAQTIANFTVLPRGTIYTDSQHP
                     ESWQKIQVLEAPRAAAPEKPDAEHDAPQFIEPLDSIDRMEFQSAHFQTKVTPQTDPNL
                     RIQWFKDGQPLMNSNRFKLTTDFGYISLDIAHTVPEDSGVYSVKASNAKGDAEVQAQL
                     TVTGNAVILGDTQHEQSWQKIQLIEAPRAPGEEEPDVKHGPPKFVTQLHSLDGVVEGQ
                     PSHFEAQFIPFSDPKTSVQWYLNGNPLSASSRRILRNDFGLVSLDLQYTLGEDAGEYS
                     VVVKNSEGEDRTSGQLSCTTRAAILGDTQHEQSWQRIQEIEAPRAPGAEPEGPVYEKP
                     SFVQPLQSVGDLPEGSVALLEARLVPVNDPNLRVQWFYNDQPLMESNWISTSNDFGCV
                     SLRIAPVYARHTGVYSCKAWNDSGNAVTSANVGVQGSEGLLLDTSHPASLQKIQELEA
                     IDKYARLDAPEREYEKPQWVQGFENYENVGEGQTVTLHGLVEPSGDPHLRLEWLLNGT
                     PLRNANRFRQEYEFGNAILTIVHVLPHDSGVYTCRAWNTQGEASTSATVTTAGYEKIL
                     YDSQHPVSWERIQELEAPKIVEEIEEIVQKEKPNFLTQLESAENVPEGVPLHLESTFQ
                     PARDPELKVVWQKNGQPLGASQLVQTKHELGWATLDISSANEDHNGVYTLTITNSEGE
                     AVSTASIRVAGTGPILGNTRHEESWKRIQILEAPKEAEPEAPAPVYDHPAITTQIDDK
                     ECNEGDHVHFEALITPVNDPRLQVQWIRNGVPLAHGSKYAIQQDFGICTLDVAYTYPE
                     DEGVYQLRIWNPEGEAVSSATLKCHGKDAILGDVQHQESWKRIQEIEAPKQKLEEADP
                     EPKGPPRFIQQLTSPGSLVENQPAHFEATVEPVDDPTLTINWFLNGEPMSASSRVKMI
                     NDFGWVIMDIAQTEPRDSGEWKCVAKNAAGEAVSTATIEVQGKEVILQDSLQPQSLDR
                     IRQIEAGKPAPEERPDQQFEAPAIVNALQVQGALEEGGSAHLQTQFTPVADPSIKVEW
                     LKDGQPIFHSNRYKMVHDFGFAVLDILHLLKHDAGEYTFRVSNNSGEASTSTSFEVSE
                     SSGLILQPQNEQKAKAVEILEDNLRRRPEEIEQELKEATPVFIEPLSAPVETEEGGRA
                     HFTARYEPVNDNQLQVQWYHDGRPLKNGSRIKTINSFGYVVLEISPTYPEDNGEYICR
                     AVNRVGEAVTSTKLTCTPKEGIISATQLPERMANAGRRIAEIEAPRPAREDAPDADHG
                     PPKFTSALAGPPELQEGQQAHLECQVTPVADPRLVIEWFHNGQPVNHTNRMKAIHDFG
                     FVVLQLTPAEPQDSGTWTCRATNQHGSDEVSTELKVVGGGGVSYEWQSTAERKERITE
                     LEDWIHRPKEDLNLPAVDYPAPSFSQGLTDLGQLNEADATAFVCVLEPIGDPTLRVQW
                     EHNGHPIPYSNRISCTNEFGVATLLIKHLIAADAGEYKCVATNVKGSATSVGKIAVES
                     STQIDAPQVVQQLVDSVENILEGDSIHLECRVTPINDPRLHVEWLRNGAPLPEASRFK
                     PTFEFGFVSLDILYAYPEDNGDYELVVRNDKGEARSKTKITVLPRPSLDYTSQTHGNQ
                     QDSLESHFKQHSQAKLQLTANDIYNESDKRAPEFRTQLQNIGVLEGEFCRFETQVAPI
                     NDPYLKVEWFKDKKPVLLGHRFRSTLDFGFACLDLLYALPDDTGEYHCVATNRHGQTM
                     ISAKLACQGASHVITDSQMPQGLRVSNVKKDNKNIYWSEQGGAVQPKQKQAPQFTIPL
                     RNLQVTENQPARFECAVTGYPRPKVTWFINGNQCLHGHRFKLNFDGLHYLTVSKSRIS
                     DAGEVVAIARNTEGETISTATLDIFQNDDFRQTKLRPANFKTSDELRERELQWQRDTL
                     GSLGPAFEAAPKPDAQKLMHVERAQSPIEPMESQELIQKFTRPRDDNFYNKLSYVELQ
                     KPQFKGMELEEVNLKAGKVEKYQPPVEEMERVNLKAIPEKDQQEVGWERPDWAGQDGT
                     SKLPGADEGRFKKLPTPAPELDVPARDQVKLKTAKPTRGKDLEAGEKVKLKTEKAKIK
                     EIQQKPEQPKEEPIVHKDAVQLKTQQLPKTGIKGDHFTVDREKDLKETPAVVKPVIEE
                     TRISNKPQPTKIGQSKQAPPTISQQLKPLQGELGKAAKFVIEFAGAAPVKVTWLKDGK
                     EIKSTFRTLITTTPTNSSLHIGRLENSHAGEYTVRLENAAGTVESLANLTVAPPTTQG
                     KAPDFSARLNDLRIQQNGPAEFSCQIGGEPKPTIQWFKDGQPLPNDDRFQVVEEGGAY
                     KLKFSNIISTDAGIYEIVAKNGVGEARCKARLNVNLQKTGKGAEEGPRYEAPRFTSQI
                     QPIVVDEGKGAQFSAQFSGFPDPTIRWYRNNEPVKHADGYEISQSKGEAILRISAARN
                     EDVAEYKVEASNPAGKASSVANLVLTPRSGRIAKSTISRGGSASYQSSDKAAADSPHF
                     IAKLSDISARQGHTVKFSAEVDGNPEPTVQWQFKGKPISASNNVKISRDGKRAILELA
                     RVTPDSAGEYQIVIRNDKGAATSQAKLTLSR"
     STS             3774..4205
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /standard_name="R05D8.p"
                     /db_xref="UniSTS:324253"
     STS             6226..7408
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /standard_name="F54E2.3"
                     /db_xref="UniSTS:311783"
     STS             9173..10085
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /standard_name="R05D8.n"
                     /db_xref="UniSTS:322613"
     STS             10537..12227
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /standard_name="R05D8.m"
                     /db_xref="UniSTS:323579"
ORIGIN      
        1 atgccgttca agcaaccgct cggcgagcga gacgccgcca accgggttgc accgactttt
       61 attaggccgc tagccgacaa acgagcagtg gttggcgaga cgattattct ggaatgccaa
      121 ctcgaaggtc atccggatcc ggcgatcaaa tggctcaaag acggacataa tgtttccatg
      181 tgcccagatt atcgaatcga ggaagacggg ctcaaacatc ggcttgtaat tccccaggtt
      241 caggctgctg acagtggtcg gttcacagct caagcttcaa actctgctgg aacaaagcag
      301 tcaacgtgta ttctgatttg tgctccagct ccaacacctg ttccgggtgc caagtctgct
      361 gttgcatccc ctgctccccc acaaacaccc gtcggaccat ctgcgccaat tttcctgaaa
      421 gagctccgtc atcagccgct gaaacccggg gcaggagtga cttttgaagg tcgagttatc
      481 gcagttccac caccaaacat cgagtggatg aagaatggca agcccctgca aaactatcgt
      541 gcaaaaattg agcatgacca gaaaactgga ataatctcgt tgatcatccc acagatgttc
      601 aacgacgacg ctggcgagta cacgatcaaa gccacaaatg tgcacggaga ggcgatcagt
      661 ggagcacagc ttctgcccag ggagcagtac gatagatggt tttctaatga gcagacacgg
      721 ctcacgaagg ataggaaaca agggttactg tcacagacgc tgaggccgag cagtgtggct
      781 cagaagcaaa tgcaaaagca gggttatgat acggatcagg ggagtgttga tatgcactgg
      841 acaatttccg agtcggaaac cgaacccgag ctttccgcgt tagatgctcg cggagttggt
      901 accaagccca tcatccgtac acctctccga ggccttcgac taacagaggg caccgacgca
      961 attctacaag caaatattgt gggcaacccg aaacccagaa tccaatggct tttcaacgga
     1021 cgcccgttac aagtttccgg gccccgaatg cagatgacat ataagggatc gatggcggtt
     1081 ctgaaaatct ccatggttac aacagaagaa gccggagatt atacagtggc gtccgagaat
     1141 cgtttcggaa aagtcgaaag ttcagcgcgc atcgaggttt acccgttgag cgtgccggac
     1201 gaacgacgaa aggaaaatca gctccgcgag caacaagagc gtgatcgtca gcaacagcaa
     1261 caggcgctcg tcgaggcgag tctcgcgcgt gagagacaac gcgacgccga gaaccgacgt
     1321 atccgtgaag agcaggaccg tcttcgtgtg ctttttgaac gcgaaaaagc ggaacgcgag
     1381 cgattggaag aggagcgtcg gcagttggag cacgagaagc gattgcggca gcagcagcag
     1441 caacagcttt tcgaacgtga aaaatctgag aaagaggaga gagcacggct tgaagaggaa
     1501 cgccgtcggt tggaacacga gaagcattta aggcaacagc agcaaactca gccttataat
     1561 cttcactacc agcaacacca ccaaccacat caagcctggc aagatttaga cctcgttcgt
     1621 cgacctcaat acgcttctga cgaatatcaa gaaccgcatt acgcgcagat cagaccacat
     1681 caacagcagc agcagcacta tcaacaacaa caacaatcac cacgtcaaga agtaacacat
     1741 caaaacctat acgaacagca tcgtagacaa caacagttga ttagagagca gcaactctat
     1801 caacaccaac atcagcagca ccaacaacaa caacaacaac ctcaggaaca gcagcagcaa
     1861 cggttccatc actttaatca atatcaacag catattcgag aacaacatca gaacactatg
     1921 ccagtattca gacagcagca accaacccaa gtcactaacg gaggaatcaa agcagcaaat
     1981 ggttccgcaa aaactgcaaa cgggtcagca aacgggtcgg caaatggatc cgccgtacac
     2041 gcagcaaacg gcggaccatc atctcaacaa gcacgcgggc acgaacacgg agcagcactc
     2101 gtgaacgccc gtcccccaca attcctcgtc catccacagt ccgtcgcagc aaaggccttt
     2161 gaaacagtga cattcagcgc aaaggtcgtc ggaacaccaa ctccgtcgct gacgtggcag
     2221 aagtccgacg gaactgttat tcagtcggga ggaaagtaca agatcgagaa tgggccagac
     2281 ggcagcggtc ggcttattat cgagaaagtg gacgcacacg acgccgacat gtacatgttg
     2341 gtagccagaa atgatggagg atcgttccag agcaggttct cactgaacgt tcttcaagct
     2401 aagtcgcctg aagctccaga attcactgga aagttccagt caacaacgct ttacgacgga
     2461 gattctgtga agctctactg caaagcagca ggagaaggag tgagcttcaa gtggttcaag
     2521 gataatgaac cgatctcatc aggcggcagt tatgccgtcg acaacaaagg caacgagacc
     2581 acgttgcaca tcaacaatgc cacaatgaaa gaaggaggat ggtaccggtg cgatgcaacc
     2641 aacaagcacg gaacaactac tctgaaggga cgcgtcgtgg tgaactctcg acaaaagttc
     2701 aacgggccgg ctcacagaga aatgatcacg ctgagaaaag ttgacaaggt tgaaagatcg
     2761 cgaacaccgg tgaatcagct tcaagatgtt tccgcatcaa agtcgtcgcc aaagttcgaa
     2821 ggatcacttc aatcgcaaca actcgttgaa ggacagtcgg ccagacttga aatcaagtac
     2881 acaccagtcg aagatccgaa tctcagaatt gcgtggctcc tcaatggaaa gggtattttg
     2941 gcctcttcca gaattgtgac ctttaccgat ttcggaattg cggcgctgga aatcaaccca
     3001 gtcaatgtat tcgatcaagg agagtacact gtcgtcgcag tgaatccact tggtgaagct
     3061 cgagtctctg caaacatcgc ggtcatcggt catggaagct tcatccaaca acaacaatca
     3121 ggaagccaat tcggaggaac tgcctatcaa tcgaagggtg cgcaagctcc tgctggaact
     3181 catcttgatt tgccgaactt ccattctgac ttaagatctc aagaagtttt tgaaggtcag
     3241 caaatccact tggagacaaa gcttacaccg atcaatgatc ctgatcttcg agttgtgtgg
     3301 cttctcgatg gaaatgaatt gccaagcaat gacaaatacc gtcaaaccct atctcatgga
     3361 ttcgcttcac tggatatacc acaaacctca agcaatgata gcggactcta ctcgtgccgc
     3421 gcattcaaca agctcggaga atccgagaat caggccacta tcatcattgt gccaaaatct
     3481 gatctccaac aattcgaaca acatcgtcaa ctcgatgttg aggatgttcg agagattcag
     3541 ttcgcccact cttctcaaga cctgacgcca aagttccttt ctcaaatcca accattccat
     3601 tgcgaacagg aacttggaag atcgttcttt gaagcgagaa ttcagccgat caacgatcca
     3661 actcttcggg tgtcatggct taaggatggt caaccactcc ccaacgccaa tcgcatccaa
     3721 attttccaaa actttggagt cgtgtcactc tcgcttcatc caacttaccc cgaagatgct
     3781 ggagtctata cttgcgtact tttcaattcg catggacaag ctcaatcatc cgctgagctg
     3841 acaacagtct ggatcgacac tctccagctt gactccaagc atgctgatag tcttccaatt
     3901 attggctacc ttgacagtca tcaaatccat atcgggccac aatctgtgga gcggcctgaa
     3961 gagttcaact ccttggaggc tcccaagttt gctcgcgagc ttgccggcaa aatcgaagtc
     4021 atggagaacg agcgagtgca cttcgaggct agaatccttc cagccaacga tgtgaagatg
     4081 acagtggagt ggtaccacaa tggcaacccg cttccagctg ctcatcgctt ccacccaatg
     4141 tttgatttcg gctatgttgc tctggatctg ttgtacgctt atccacaaga ctctggaacc
     4201 tacacattgg ttgcgagaaa tgaactagga gaagctcgaa gcaacgtgga gctggttgtt
     4261 ggcactgaga aagtacttta tttggagcca catcacccag aaggattgga gagaattaag
     4321 gagctcgagc aagatcgtcg ccaaggcatc gccgaagttg aagatcgcac ttgtgacgcg
     4381 gcccccaaat tcctcaacga tcttccggat atccagctca atgagcacga gaatatccac
     4441 gttgatcttc gcgcaacgcc agtcaatgac ccgacgatgg tcattgaatg gtttgtcaac
     4501 ggacgcccat tgttgactgg aagtcgtgtc aagaccctca acgaatttgg tttcattgct
     4561 ctagacatca aaggagcgat tgccgaagac tctggaacct actcggtcag agccagcaat
     4621 cttctcgggg aggccattcg ccaatgcgtg attactgtta cgccagccgg ccaaattctg
     4681 tccgacactc aacatcaaga atctctcgga aaaatcaact atctcgagaa tcttaataag
     4741 tacggaagag tggagattga agataagggg ccacaagagc caccgacatt cgttgttcca
     4801 cttcaagccg atttgggaga tgttgaagaa ggcgagccaa tccatttgga gtgccaagta
     4861 aacccgatca atgacaactc cttgaaaatc atatggctcc gtgatggaca gtcgcttcca
     4921 catggtcacc gtttccgtac attctatgat ttcggatttg tgtcactgga tattctcggc
     4981 ttctacgctc aagacgccgg aacatacact tgtcgcgcag aaaattcgct ggggcaggct
     5041 gaaactgttg ccactattag atgtgcacca aaagatgcca tcctcggagc agttcaacac
     5101 ccaagaagct atgctagaat tcaggagatt gaggcgccga aaccagcgcc acaagaggtt
     5161 ccagatcttc cacatcagcc accagcattc gtgaagcagt tgggaccagc tattcagtgt
     5221 atggagggag acaatgtgta cctagaggct caagtgacac ccactgatga taattcgcta
     5281 acttacgaat ggctcgtcaa tggtcagcca ctcatgaagg cccatcgttt tgtattgtct
     5341 caagactttg ggtacattgc gctgaacatt ctctactgtt atccggaaga taatggtacg
     5401 tacacactag ttgtgcgaaa ccgagcagga gaagctcaat cgacggtcga catcaactgt
     5461 gggcatactg gaggaaattt caccgactca ttccatccaa actctctcca tcgtattgcc
     5521 gagctcgaga ctcctattca acgagccgag ccacttccag acaaggaaaa ggaagtacca
     5581 acgattgcca agccacttcc agcgactatc gactcggtcc acgagtcaca gactcttcat
     5641 ttggaggctc aagtcacccc gattgacgat aatactctga gatacgaatg gttgttcaac
     5701 gggaacccac tgaaggcatc cagcagatat cgtgttctca atgactttgg atttgtgtcc
     5761 ctcgacattg actacatcat tgccgaggac agtggaaagt acaccttggt cgtttacaac
     5821 tctgccggac gtgctgagac ctcttgcgaa ttccaagtcg atcgcctgaa gtcgattctc
     5881 tccgacaccg ctcatccgga atctcttcgt cgtattcgtg agatggagca acttcaacca
     5941 gctaagccat cggatgatga tgcagctgct cagccaccgg tgttcactca acaactcacc
     6001 ggaccaactg agccactcaa ggaaggacaa tcggttcata tggactgcgt tgttcagccg
     6061 atcaatgatc ctagtctgag aatcgagtgg ttccacgacg gaagaccatt gatgttcgga
     6121 tcgcgtatcc gtactattca cgactttgga tatgtcggtc ttgagttcct tcacatccac
     6181 ccagaggata ctggaactta cacttgcaag gctaccaatc ttattggtga agctaccacc
     6241 gacatcttct tggagtgcaa gccacgtcgc aacatctatc ttgacactca ccacgagtct
     6301 tcgtggcaga agattcaaga aatcgagaac cgtgtggatg agcgtgaacc aacgccggaa
     6361 cttacattcc agccaccaac gttcactgag aacctggctg acaaggaaga tgctcaagaa
     6421 ggacaatcga ttcgtctcga gtgccgcttg attccagtta acgatccaac aatgagagtc
     6481 acttggacaa gaaatggtca gccacttcca gaagcttcaa gattcatgcc agcaagaaac
     6541 tttgattatg tcaacttgga cattcttgcg ttgtacggag aagactcagg tgtctacact
     6601 tgcaaagctg tttcagcatt cggagaagct gccacctcat gcacagtcaa gtgtgccgca
     6661 ggaaaatcac ttcttcttga taccatgcat gatgcttcct ggaagcgtgt tcaagaaatt
     6721 gaaaaccgtg agaagctaga ggcagtggat gctgagccag aaaagactgc accaaagttc
     6781 gtcactcagc tcaattcctc ccttggagag cttcaagaag gagttccaat tcatttggaa
     6841 gcacaagtgg agccaacaaa cgacaatcag ctcacagtac aatggttcca caatggacaa
     6901 ccacttgcca atggacatcg tttccgtact cgtcacgatt tcggatatgt cgctcttgac
     6961 atcttgtacg catttgcgca ggatactgga gaatgggcat gtgttgccag aaactccctc
     7021 ggagaggcac agaccatcgc aaacttcaca gttttgccac gtggaactat ctacaccgat
     7081 tctcaacacc cagaaagttg gcagaagatt caagtacttg aagcaccacg agctgcagca
     7141 ccggagaagc ctgatgctga gcatgatgct ccacaattta ttgagccact cgacagtatc
     7201 gatagaatgg aattccaatc agctcacttc cagaccaagg tcactccaca aacggatcca
     7261 aaccttagaa tccaatggtt caaggatggt cagccattga tgaactctaa ccgattcaag
     7321 ttgactaccg acttcggata catctcactg gacattgctc acactgttcc agaagacagc
     7381 ggtgtctatt cagtcaaggc aagcaatgcc aagggagacg ctgaagttca agctcagctc
     7441 actgtaactg gaaacgctgt tatccttgga gacactcaac acgaacaatc atggcagaag
     7501 attcagctca tcgaagctcc aagagcccct ggagaggagg agcctgatgt caagcacgga
     7561 ccaccaaagt ttgtcaccca attgcatagc cttgatggag tggttgaagg acagccatct
     7621 cactttgaag cccagttcat tccgttctcg gatccaaaaa catctgttca atggtatctc
     7681 aacggaaatc cactctctgc gtcttctcgc agaatcctac gcaacgattt tggacttgtc
     7741 tccttggatc ttcaatacac acttggagaa gatgctggag aatatagcgt cgttgtcaag
     7801 aactctgaag gtgaagatag aacatctgga cagctgtcgt gtaccactag ggccgcgatt
     7861 cttggagaca ctcaacacga gcaatcgtgg cagagaattc aagagatcga agctccaaga
     7921 gctccaggcg ccgagccgga aggaccggtc tatgagaagc catccttcgt tcaaccgctt
     7981 cagtccgtcg gagatctgcc tgaaggatct gttgctcttc tcgaggctcg tcttgtccca
     8041 gtcaatgatc caaatcttcg agttcaatgg ttctataacg atcagccatt gatggagtct
     8101 aactggatct caaccagcaa cgactttgga tgtgtctcgt tgagaattgc tccagtgtac
     8161 gccagacata ccggagtata ctcttgcaag gcctggaacg acagtggaaa cgctgtcaca
     8221 tctgcgaatg ttggagttca aggatcagaa ggccttcttc tggatacttc tcatccagcg
     8281 tctcttcaga agattcaaga gctcgaggct atcgacaagt acgcaagact tgatgcacct
     8341 gaaagagaat acgagaaacc tcaatgggtt caaggattcg aaaactacga aaatgttgga
     8401 gaaggacaaa ctgtcactct tcatggactc gtcgaaccat ctggagatcc acatcttcgt
     8461 ctcgaatggc tccttaacgg aactccactt cgaaatgcaa accgtttccg tcaagagtat
     8521 gagttcggaa acgcaatcct caccatcgtt cacgtcctcc cacacgactc tggtgtttac
     8581 acctgccgtg cctggaatac tcaaggagaa gcttcaacat ctgcgaccgt gactactgct
     8641 ggctacgaga agattttgta cgactcgcag cacccagttt catgggagcg tattcaagag
     8701 cttgaggctc cgaagatcgt cgaggaaatt gaggaaattg ttcaaaagga gaaaccaaac
     8761 ttccttactc aactggagtc ggctgaaaat gttccagaag gagtcccact tcacctggaa
     8821 tctacattcc agccagctag agacccagaa cttaaggttg tttggcagaa gaacggccag
     8881 ccactcggag cttcacagtt ggtgcagact aaacatgaac ttggatgggc tacactggac
     8941 atttcctcag caaatgaaga tcacaatgga gtgtacactc ttacaattac caacagcgaa
     9001 ggagaggctg tgtcgaccgc ttcaatccgg gtagccggaa ctggaccgat tcttggaaac
     9061 actcgtcatg aagaatcatg gaaacgcatc cagattctgg aagctccaaa ggaagctgaa
     9121 ccggaagcgc cagctccagt atatgaccat ccagcaatca ccacgcagat tgatgataag
     9181 gagtgcaatg aaggagacca cgttcacttt gaggcactca tcactccagt caacgatcca
     9241 agacttcaag ttcaatggat tcgaaacgga gttccacttg ctcatggatc aaagtacgcc
     9301 attcaacaag actttggaat ctgcactctc gatgttgcct acacttatcc ggaagacgaa
     9361 ggtgtctatc aacttcgtat ctggaatcca gaaggagaag ctgtgtcatc tgccacgctc
     9421 aagtgtcatg gaaaggatgc aattctcgga gacgtgcaac atcaagaaag ctggaagcgt
     9481 attcaagaaa tcgaggcgcc aaagcaaaag cttgaggaag ccgatccgga gccaaagggt
     9541 ccaccacggt tcatccaaca gctcaccagc ccgggaagtc tcgtggaaaa ccaaccagct
     9601 cactttgaag ctactgtcga accagtcgat gatccaactc ttacgatcaa ctggttcctt
     9661 aatggagagc caatgtctgc gtcgtctcgt gttaagatga tcaatgattt tggatgggtg
     9721 atcatggata ttgctcaaac cgaaccaaga gattctggag aatggaaatg tgttgctaag
     9781 aacgcagctg gagaagctgt ctcaacagca acgattgaag ttcaaggaaa ggaagttatc
     9841 cttcaagact ctctccagcc acaatcactt gatcgtattc gccagattga agctggaaaa
     9901 cctgctccag aagagcgccc agatcaacag tttgaggctc cagctatcgt caacgctctt
     9961 caagtccagg gagcgttgga agagggagga agtgctcatc ttcaaaccca attcactcca
    10021 gtggctgatc cctcgatcaa ggtggaatgg ctcaaggatg gtcaaccgat cttccactca
    10081 aatagataca agatggttca cgacttcgga ttcgctgttt tggacatttt gcatctactg
    10141 aaacacgatg ctggagagta tactttccga gtttcgaaca actcgggaga agcatctact
    10201 tctacaagtt tcgaagtttc cgagagctct ggtcttattc ttcagccaca gaatgaacag
    10261 aaggcgaagg ccgtcgaaat tctcgaggat aacttaagaa gacgccctga agaaatcgag
    10321 caagagctta aggaggctac accagtcttc attgagccac tctcggctcc agttgaaact
    10381 gaggagggcg gacgtgctca tttcacggct cgttacgagc cagtcaatga caatcagctt
    10441 caggttcaat ggtaccatga tggtcgccca ttgaagaatg gaagtcgtat caagactatc
    10501 aacagttttg ggtacgtcgt tcttgagatc agcccaacat atccagaaga caacggagag
    10561 tacatttgtc gtgctgtgaa ccgtgttgga gaggcagtca cctcgacaaa gcttacctgc
    10621 acacctaaag aaggaatcat cagtgccact caacttccag aacgcatggc aaacgcggga
    10681 agacgaattg ccgagattga agcaccaaga ccagctcgtg aagatgctcc agacgctgat
    10741 catggaccac caaagttcac gtcggcactt gcaggaccac cagagttgca agaaggacaa
    10801 caggctcact tggagtgcca agtcactcca gttgctgatc caagactggt gatcgagtgg
    10861 ttccacaatg ggcaaccagt gaatcacact aacagaatga aggctatcca tgatttcggt
    10921 ttcgtggttc ttcaactgac accagccgaa ccacaagact ctggaacctg gacttgccgt
    10981 gccaccaatc aacatggatc tgatgaagta tccacagagc tcaaggtcgt cggcggtggc
    11041 ggtgtctcat acgaatggca gagcactgca gagcgcaagg agcgcatcac agagctcgag
    11101 gactggattc atagaccgaa ggaggatctc aatcttccag ccgtcgacta tccagcacca
    11161 tccttctctc aaggtctcac cgatcttgga cagctcaacg aggccgatgc tacagcgttt
    11221 gtgtgtgttt tggagccaat tggagatcca actctccgag ttcaatggga gcataatgga
    11281 catccgatcc catactccaa tcgtatatct tgcacaaatg aatttggagt tgccactctt
    11341 ctcatcaagc atctcattgc cgccgatgct ggagagtaca agtgtgttgc cactaacgtc
    11401 aaggggtccg ctacatctgt cggaaagatt gccgtcgagt catccactca aattgatgct
    11461 ccacaagtcg ttcaacaact cgttgacagt gttgaaaaca ttttggaagg agattcaatc
    11521 cacctcgaat gtcgtgtcac tccaatcaac gacccacgtc ttcatgtgga atggctcaga
    11581 aatggagcac cacttccaga agccagtaga ttcaagccaa cgttcgagtt tggctttgtc
    11641 agcctggata ttctttatgc ttacccagaa gacaatggag attacgaact tgtcgtccgt
    11701 aacgacaagg gtgaggctcg ttccaagacg aagatcacag ttcttccaag accatctttg
    11761 gactacactt ctcaaactca tggaaaccaa caagattccc tggaatctca cttcaaacaa
    11821 cattctcaag ctaaacttca gctcaccgcc aatgacatct acaacgagag tgacaagcgc
    11881 gctccagagt ttcgtactca acttcagaac atcggagtct tggaaggaga gttctgccgc
    11941 ttcgagaccc aagtcgcacc aatcaacgat ccatacctca aagttgaatg gttcaaggac
    12001 aagaagccag ttcttcttgg acatcgtttc cgatcaactc tcgactttgg attcgcttgc
    12061 ctcgatcttc tgtatgctct tccagatgac actggagaat atcactgcgt cgccacaaac
    12121 cggcatggtc aaactatgat cagcgctaag ttggcgtgcc agggagcttc tcatgtgatc
    12181 accgatagcc agatgccaca gggcttgaga gtcagcaatg tgaagaagga caacaagaac
    12241 atctactgga gtgaacaagg aggagctgtg cagccaaaac aaaagcaggc accacagttc
    12301 actattccac tccgaaacct tcaagtcaca gagaatcagc cagctcgctt tgaatgcgct
    12361 gtaactggat atccaagacc aaaggtcacc tggttcatca atggaaacca atgtctccat
    12421 ggacaccgct tcaagctcaa cttcgacggt cttcactatc ttaccgtcag caagtccaga
    12481 atctcagacg ctggagaagt tgttgcgatt gctagaaaca ccgaaggaga aacaatttct
    12541 actgctaccc tcgacatctt ccaaaacgat gacttcagac agaccaagtt gagaccggct
    12601 aacttcaaga catccgatga gttgagagaa agagagttgc agtggcaacg tgatactttg
    12661 ggatctcttg gcccagcgtt tgaggctgct ccaaaaccag atgctcaaaa acttatgcac
    12721 gtggaaagag cccaaagccc gatcgaacca atggagtccc aggagcttat tcagaagttc
    12781 acacgcccac gcgacgacaa cttctacaat aagctttctt acgtcgagct tcagaagcca
    12841 caattcaagg gaatggagct cgaggaagtc aatttgaaag ctggtaaagt tgagaagtat
    12901 caaccaccag ttgaagaaat ggaacgagtc aatctcaagg ccatcccaga aaaagatcaa
    12961 caagaggtcg gatgggaaag acccgactgg gccggacagg atggtacgtc gaagttgcca
    13021 ggagccgatg aaggtcgctt caagaaactt ccaactccag cgccagagct cgacgttcca
    13081 gccagagatc aagttaagct taagaccgca aagccaacac gtggaaagga cttggaggcc
    13141 ggtgagaagg tgaagctgaa gactgaaaag gcaaagatca aggagattca acaaaagcca
    13201 gaacagccaa aggaagagcc aattgttcac aaggatgcgg ttcagcttaa gactcaacaa
    13261 cttccaaaga ctggcatcaa gggagatcac ttcaccgttg acagagaaaa agatctgaag
    13321 gagactccag cagtggtaaa gcctgttatt gaggagacaa gaatcagcaa caagccacaa
    13381 ccaacaaaga tcgggcaatc taagcaagct ccaccgacaa tctcccagca gttgaaacca
    13441 ctgcaaggag aacttggaaa agccgccaag tttgttatcg aatttgccgg tgccgctcca
    13501 gtcaaggtca cttggcttaa ggacggaaag gagattaaga gcactttcag aactttgatc
    13561 actaccactc caacaaactc cagccttcac atcggtcgcc ttgaaaactc ccacgccgga
    13621 gaatacacag tacgactgga gaacgccgct ggaaccgttg aatctctagc caatcttact
    13681 gtcgctccac caaccacaca aggaaaggct ccagacttct cggcgcgtct caacgatctc
    13741 agaatccaac agaatggtcc agctgagttc tcctgccaaa tcggaggaga accaaagcca
    13801 acaatccaat ggttcaagga tggacaacct cttccaaatg acgatcgatt ccaagttgtc
    13861 gaggaaggag gcgcctacaa gctcaagttc tcgaacatca tctctaccga tgccggaatc
    13921 tacgagattg ttgctaagaa cggagtcgga gaggctcgct gcaaggctcg cctcaacgta
    13981 aacctccaga agaccggaaa gggtgccgaa gaaggaccac ggtacgaagc gccaagattc
    14041 acatcccaga ttcaacccat cgttgtcgat gaaggaaagg gtgctcagtt tagtgcacag
    14101 ttctccggat tccctgatcc gacgatccga tggtatagaa acaatgagcc cgtgaaacac
    14161 gccgacggat atgagatttc ccaatcgaag ggagaagcca tcctgaggat atctgcagcg
    14221 agaaatgaag atgttgcaga gtacaaggtt gaagctagca atccagccgg aaaggcttca
    14281 tcggttgcca acttggtttt gactccacga tccggaagaa tcgccaagtc gacgatttcc
    14341 cgtggtggat ctgcatcata tcaatcgtcc gacaaggccg ccgccgactc tccacatttt
    14401 atcgcaaaac tttccgacat ctctgcccga caaggacaca ctgtcaaatt cagcgccgag
    14461 gtggacggaa atccggagcc aactgttcag tggcaattca agggaaaacc aatttctgcg
    14521 tctaacaacg taaagatctc acgtgacggc aagcgtgcca ttctcgagct ggctcgagtc
    14581 acgcccgaca gcgccggaga gtaccagatc gtcatcagaa acgacaaggg agctgccacg
    14641 tcacaagcca agctcacact cagtcgctag
//