Dbfetch

LOCUS       NM_001307088            4368 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans KiDINs220 (vertebrate scaffold protein)
            homolog (kdin-1), partial mRNA.
ACCESSION   NM_001307088
VERSION     NM_001307088.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 4368)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 4368)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 4368)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 4368)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..4368
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>4368
                     /gene="kdin-1"
                     /locus_tag="CELE_F36H1.2"
                     /db_xref="GeneID:178000"
                     /db_xref="WormBase:WBGene00006490"
     CDS             1..4368
                     /gene="kdin-1"
                     /locus_tag="CELE_F36H1.2"
                     /standard_name="F36H1.2h"
                     /note="Product from WormBase gene class kdin;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="KiDINs220 (vertebrate scaffold protein) homolog"
                     /protein_id="NP_001294017.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006490"
                     /db_xref="EnsemblGenomes-Tr:F36H1.2h"
                     /db_xref="GeneID:178000"
                     /db_xref="GOA:A0A061AJK4"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR011646"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="InterPro:IPR036770"
                     /db_xref="UniProtKB/TrEMBL:A0A061AJK4"
                     /db_xref="WormBase:WBGene00006490"
                     /translation="MVQTLRRPWQEAASSAFAVASALPVTMNSTQIAELFEQVEHGTT
                     ELRCALTAEISALRNANGESLLTVAVRSGNTAVAKQLAQLDPDAIDETDNEGWSALLN
                     AAHCGHVDIVRLLIDNGASVDQPDLMGWSPLMWAVYKNHLDVVDLLVNAKAHVNLIDE
                     EDGLTPLIVASGRGFSQIVERLIDSDCQVNACDKFGSTALIWAARKGHLPVVQLLLNS
                     GAEVDAVGMYSSTALMLATRGNFIQVVELLLTREPNVNVADQNGLTALGMAARDGYAD
                     ICESLINSGAFVNQCDRFGNWILTSAVRSGNAAIVRMILDKFADINCQDSEKRTPLHL
                     AIDKSFNDIAYILLEKKPNLELKNKDGETPLLRAAKCRHVHLCTYLMSFGAKLAAVDN
                     CGDNALHLALRARSRRLTQALLSNPSDSRLLYRPNKLGQTPYSIDLSNPQPILPLIFG
                     PIDAEDKMDTAMGYDVYSNVLADIVCEPSLSLPLTIGLYAKWGSGKSALLAKLKEAMH
                     SFSRDWLDGVSLSVSFALFFAIFLFFGMFSLTFTMLIAISNSVTAYLISWSVFLLIFI
                     IFCSLIVVVYYGDRKNWYTSMDIANFFARVFSRIRLVYNILTLHAPMNSEDSASMPVS
                     FLFADYHRLSSIGGEQALAKIVATLFEAAETHFGVLPVRLFCCMKPPYPGIHGSLRRH
                     CGVPHVILLIVAVFLLIMAQVFGTVWLLSDRDPNNFNLFIAIAFLCGFVMIAIYPLAL
                     IIMYSWTNVPRRRVNAAARNAHKLRFEGLMQKLQTEVDLLADMIRSLDAFTRSHTRLV
                     VVVDGLDNCEQERMVQTLDALELLFSARKHRPFITIIAVDPHVIVSAINHNMHSALSG
                     TELTGHDYLKNIISMPFYLHNSALRQLQSKLREKRESMAEWKERFKRQDTFYGSHLSL
                     READGRTSRKSFQKSTVPNMNSNSVVGRNMNDGILGEDYFSNMNPRAMRRIVNALTLT
                     GRLMRAFEIDFSWMSLGHWVSLLEQWPSRMCWLIDRALEVHNNQLLLSEVYYQLKDHI
                     PAQDDLMQLDRNLENFEGFLDSKGIPSAERLTVGHVKKFVPCTSSLDPYLRKLIRERS
                     KGLVDIEAQVGSAGMAIPPNARLLFSDDLTWMSIDTPLVEMKLDAVVNLIRKIDIPSN
                     RLDSILDRFYQLNLCGLVLATCPLPELKDSMQLPLGDWTLIRLLLETLKVFGSSPPGL
                     RVDKRKALTLREEDEEEEIEEAAEAALNSEKERAPLLGSVRAEQRRRSTIVQNATELS
                     IDHKCLMEKLSGMDLTETEGDVNEMHFSHFSSSTDGPSPMADGFLPASVSAAPSVRFD
                     DNINDLEREASDADSTQSRYDSKENLLEDERSASPPAHVDLMRFDSGNTSSDFVRSSY
                     RTSSRYRRMSRGDLMRGMHQNDTIRSSMDQSGTGAAPSSSSLMASDEDLNQQTVQRRG
                     GDDFERIQLEQLFNRQSDA"
     STS             2986..3853
                     /gene="kdin-1"
                     /locus_tag="CELE_F36H1.2"
                     /standard_name="F36H1.2"
                     /db_xref="UniSTS:321448"
ORIGIN      
        1 atggttcaaa cactgagaag accgtggcaa gaagcggcaa gcagtgcttt tgccgtcgcc
       61 agtgctcttc cggtgactat gaatagtaca caaattgctg agctcttcga acaggttgag
      121 catggcacca cagaactcag atgtgcactc accgcagaaa tatcagctct cagaaacgct
      181 aatggagaat cacttctcac agttgccgtt cgatcaggaa acacagcagt tgccaaacaa
      241 ttagcacaat tggatccaga cgcaattgat gaaactgaca atgaaggttg gagtgctctt
      301 ctgaatgcag ctcactgtgg tcatgttgac attgttcgat tattaattga taatggagca
      361 tctgttgatc aacctgattt aatgggatgg agtcctctta tgtgggcagt ttataaaaat
      421 catttagatg tggttgatct acttgttaac gcaaaagctc atgtaaatct tattgacgaa
      481 gaagacggac tcacaccgtt aattgtagct tctggacgtg gattttcaca aattgtagag
      541 cgattaattg attcagattg tcaggtaaat gcctgtgaca aattcggaag tactgcatta
      601 atttgggcag ctcgaaaagg acatcttcct gttgtacaac tacttttaaa ttctggagct
      661 gaggtggatg cagttggaat gtactcatcc acagctttaa tgttggcaac acgtggaaac
      721 tttattcaag tagttgagct tcttctgaca cgagaaccaa atgttaatgt agctgatcaa
      781 aatggtttga cagctctcgg aatggcagct cgtgatggat atgctgatat atgtgaatct
      841 cttattaatt cgggtgcttt tgtgaatcag tgtgatagat ttggaaactg gattcttacg
      901 tcagcagttc gaagtggaaa tgcggcaatt gttagaatga ttctcgacaa atttgctgat
      961 atcaattgtc aagactctga aaaacggaca ccacttcatc tggccatcga taaatcattc
     1021 aatgatatcg cctacatttt attggagaaa aaaccgaatt tggaactgaa aaataaggac
     1081 ggtgaaactc cacttcttcg tgctgctaaa tgtcgtcatg tacatctgtg tacctacttg
     1141 atgagtttcg gagctaaact cgctgcagtt gataattgtg gagataatgc acttcatttg
     1201 gcactgagag cacgtagtcg acgattaaca caggcacttt tgtccaatcc atcagattct
     1261 cggttactgt accgacccaa taagcttggt cagacaccgt attccattga cttatcaaat
     1321 cctcaaccta ttctgccact aatttttgga ccaattgatg cggaagataa aatggataca
     1381 gctatgggat atgatgtata ttctaatgtt ttagctgata ttgtgtgtga accttctctt
     1441 tctcttccac ttacaattgg actttacgcc aaatggggat ccggaaaatc agcacttctc
     1501 gcaaaattga aagaggcaat gcacagtttc tcaagggatt ggcttgatgg agtttcgctt
     1561 tcagtttcgt ttgccttatt ctttgccata ttcctctttt ttggaatgtt ctcactaact
     1621 tttacaatgc tcattgccat ttctaactca gtcacagcat atctcatctc atggtccgtc
     1681 tttcttctca ttttcatcat attctgttca ctgattgttg tggtttatta tggggatcgc
     1741 aagaactggt atacttcaat ggatatagcc aatttttttg cacgggtgtt cagtcggatc
     1801 cgattggttt acaacatttt aacacttcat gcaccgatga acagtgaaga tagtgcaagt
     1861 atgcctgtta gttttctctt tgccgactac caccgtcttt cttctattgg aggcgagcaa
     1921 gctcttgcta aaatcgtggc gacattgttc gaggcagctg aaactcattt tggagtgctt
     1981 ccagttcgac ttttctgttg catgaaacca ccataccctg gaattcatgg atctttacgt
     2041 cgtcactgcg gtgttcccca tgttattctt ctgatcgttg ccgtctttct actaatcatg
     2101 gctcaagttt ttggaacagt ttggctactt tctgatcgag atccgaataa cttcaatcta
     2161 ttcatagcaa ttgcattcct ttgtggattt gtaatgattg ccatctatcc attagcatta
     2221 attataatgt attcatggac aaatgtacca agacgaagag tcaatgcagc tgctcggaat
     2281 gctcataaat tacgatttga aggtctaatg caaaagttac agaccgaggt tgatcttctt
     2341 gctgatatga tccgatcact cgatgctttc actagaagtc acacacgtct cgttgtggtg
     2401 gtcgatgggc tcgataattg tgagcaggaa cgaatggttc agactcttga tgctcttgag
     2461 ctattattct cggcccgcaa gcatcgcccc ttcatcacaa ttattgctgt ggatccacat
     2521 gtaatagtat ctgcaatcaa tcataatatg cattcagcac tgtctggcac tgaactcact
     2581 ggacacgact atctgaaaaa catcatcagt atgccgttct atcttcataa ttctgctctt
     2641 cgtcagctac aatctaaact tcgtgaaaaa cgagaatcga tggcagaatg gaaagaaagg
     2701 ttcaaacgtc aagacacatt ctatggatca catctttcat tgagagaagc tgatggaaga
     2761 acaagcagaa agtcatttca gaagtccact gttccaaaca tgaactcgaa tagtgtggtt
     2821 ggtcggaata tgaatgacgg aattcttggc gaagactact tttccaatat gaatcctcgt
     2881 gccatgcgtc gtattgtcaa tgctttaact ctaactggac gtctcatgag agcttttgaa
     2941 attgactttt catggatgtc actcggacat tgggtatctc ttctcgaaca atggccttca
     3001 cgaatgtgtt ggcttattga tagagctctt gaagttcaca acaatcagct tcttctatct
     3061 gaagtatact atcaactcaa ggatcacatt ccagctcagg atgatttgat gcagctcgac
     3121 agaaatttgg agaattttga aggtttccta gattctaaag gaatcccatc agcagagaga
     3181 cttactgttg gacatgtcaa gaaatttgtc ccctgtacca gcagtttgga tccttatttg
     3241 agaaagttga ttcgcgagag aagtaaagga ttagtggata ttgaagcaca agttggaagt
     3301 gcaggaatgg ctattccacc gaatgcgaga cttttgttta gtgatgattt aacatggatg
     3361 tcgattgata ctccacttgt cgaaatgaag cttgatgcag ttgtcaacct gatccgtaaa
     3421 atagacattc catcaaatcg cctcgattca attctcgata gattctatca attaaactta
     3481 tgtggattgg ttcttgccac gtgtccattg ccagaactga aggatagtat gcaattacca
     3541 cttggtgatt ggactttgat tcgtttgctt cttgaaactc ttaaagtatt tggctcctct
     3601 ccaccaggac tccgagtgga taaacgaaaa gcactgacac tccgcgaaga ggatgaggaa
     3661 gaggaaattg aagaggcagc agaagctgct ttgaactctg aaaaagagcg tgctccactt
     3721 cttggatctg tgagagctga acagagaaga cggtccacaa ttgttcagaa tgccactgag
     3781 ctgagcattg atcacaaatg tcttatggag aagttatcgg gaatggattt gactgaaacc
     3841 gaaggtgatg tcaatgaaat gcatttctct catttttcgt cgtcaactga tggaccatct
     3901 ccaatggctg atggattcct tccagcttca gtttctgctg ctccatcagt cagattcgac
     3961 gataatatta atgatctgga acgtgaagct tctgacgctg acagtacaca atcccgatac
     4021 gattcgaaag aaaatcttct tgaagatgaa agaagtgctt ctccaccggc acatgttgat
     4081 ttaatgagat ttgacagtgg aaatacaagc agtgatttcg tacggtccag ttaccgtacc
     4141 tcatcgagat atcgtagaat gagccgagga gacttgatgc gaggaatgca ccagaatgac
     4201 acaatccgaa gcagtatgga tcaaagtgga accggagcag cgccgagctc atcgagtttg
     4261 atggcatcag atgaagattt gaaccagcaa actgtacaac gacgtggtgg agacgacttt
     4321 gagcgtatcc aacttgaaca actattcaat cgacaatccg atgcttaa
//