Dbfetch

LOCUS       NM_001306878            3360 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Prion-like-(Q/N-rich)-domain-bearing protein
            (pqn-22), partial mRNA.
ACCESSION   NM_001306878
VERSION     NM_001306878.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3360)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3360)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3360)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3360)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3360
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>3360
                     /gene="pqn-22"
                     /locus_tag="CELE_C46G7.4"
                     /db_xref="GeneID:177369"
                     /db_xref="WormBase:WBGene00004112"
     CDS             1..3360
                     /gene="pqn-22"
                     /locus_tag="CELE_C46G7.4"
                     /standard_name="C46G7.4r"
                     /note="Product from WormBase gene class pqn;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Prion-like-(Q/N-rich)-domain-bearing protein"
                     /protein_id="NP_001293807.1"
                     /db_xref="GeneID:177369"
                     /db_xref="InterPro:IPR006643"
                     /db_xref="UniProtKB/TrEMBL:V6CLW0"
                     /db_xref="WormBase:WBGene00004112"
                     /translation="MTEVCGVNVPPAIAPLFSLPQSSIDDIQNTSLNSIRSSHPFSYT
                     KPTPGGPKLHNRIKCPRVVPRSFWLSFEEDEELDVPLLEPEMPQTVHLQYNSPMGLYS
                     KEAAVEQFQQQIGETPNDLPAQEKHFDPSKSATLKYLKEGERENFGENFFEKVAQAEA
                     PRVPYQSEPNWARTAREKSERARSKTPADPHTAYRPASSPAPANHPVHAENAREHAEK
                     SKVFTHNINEPFGRSYWEASNTVPRYGRSHSVGRELYNRGYELGGMDYTGGIHVDHGT
                     DYQYYEEPARKPQTPKLPPGYELGGTDFYKGHVPGDANYRGHGPDPPRLRPKYTADSH
                     DPCNVAIAPNLEGVDANLLVGDTLSNQKIRHEVRHIDQTKFGTSFGPTKGFSYDHHTV
                     PRYVEPPKPVVYSLSANKSLARSASVPRSSAPPEQRDVWNIQQSEVDKETYITEPNWR
                     RNVDQRRLAWERRAFETEQHLSRPYSEKVAPGVPPAWHAEAQHKHQQWQQQADNMNTQ
                     NYTYSTTGYQPSQPSGGQQSYNETRQYSSNATSNYPSQTQQYQQQQHQYQSDHSNAQR
                     LLNSGYNTNQVDYVLGHKDKYNEGPHYQPPIINSSATAANNSSSSTHHYNSSSQAIPL
                     GGPNQGHSSSSYTTETRVTGGGTGAPVSNNYSNQNYSSSAYNSQSSQHQTKSIPVQNY
                     QISFPPLSVSTPAFGTSFFENSQKSFQESSEKFHRDLASPLSRTIPVQSAGHFSEVSK
                     YFNSEETNHESRQESRCHSEVAETTETSEKKEENYQVSQPAIPLPSADQVYESSNYNK
                     SYSSQTTTQHQPQPVAANNNYSTSYHTERSSTTTAQQPQTIALPPPQNNSSHTETHSS
                     TGPIMMHSPGGHSMKSTEFSSSRHHKQETTTTTTTTPQPPVFQTTTYPTTKTTSYNYS
                     SSTIPSQPAKPSFNQESYTTHTERNNSSQGFPQQRLQPSGGYSYENYSSSRKEENRRE
                     ETSRPVSQLSQYSESRNYKRNYEEKTETTTVPSLAPATNVTYKDLSNAQCVDDVFNKK
                     TEMNESLPVGSVFNTHNNTEGGYRDANGHDVSYKRETQTSADPGRETALLKEEEKRVV
                     ETPLEPGVISRHVTTKYYKKKTVTDTTTTTA"
ORIGIN      
        1 atgacagaag tgtgtggagt gaatgtgcca ccggcaatag ctccattgtt ttcgttacct
       61 caatcatcaa ttgatgatat tcaaaatact tccctaaatt caattcgaag tagccatccg
      121 ttctcttaca cgaaaccaac acctggagga ccaaaacttc ataatcggat caaatgtcca
      181 agggtagttc cacgttcatt ctggttatcg tttgaagagg acgaggagct cgacgtccca
      241 ttacttgaac cggaaatgcc acaaactgta catcttcagt acaactcgcc aatgggattg
      301 tattccaagg aggccgcagt cgaacagttc caacaacaaa ttggagaaac cccaaatgac
      361 ttgcctgctc aggaaaaaca ctttgatccc tccaaaagtg caactttgaa gtacttgaag
      421 gaaggcgaac gagaaaactt tggcgaaaac tttttcgaaa aagtggctca agccgaggct
      481 ccacgagtcc catatcaatc ggagccaaat tgggcacgca ctgcaagaga gaaaagcgaa
      541 cgagcacgaa gcaagactcc agctgatcca cacacagctt atcgtccagc aagttcacct
      601 gcaccagcca atcatccagt acatgctgaa aatgctcgtg agcacgctga aaaaagcaaa
      661 gtattcacac ataatataaa tgaaccattt ggaagatctt attgggaagc aagtaatact
      721 gttccaagat atggtagaag ccattctgtt ggacgtgaac tttataatag aggctatgaa
      781 ttaggaggaa tggattatac tggtggaatc cacgtggatc atggaactga ttatcaatat
      841 tatgaagaac cggctagaaa accacagaca ccaaaactac cacctggcta tgaattggga
      901 ggtactgatt tctataaagg acacgttcct ggtgatgcaa actatcgtgg acacggacca
      961 gatccaccaa gacttcgtcc gaagtatact gcggattctc atgatccatg taatgttgct
     1021 atagcaccga atttggaagg ggttgacgca aatttactcg tcggtgatac cctctcaaat
     1081 caaaagatcc gtcatgaagt ccgtcacatt gaccaaacga aattcggaac atcatttgga
     1141 ccaactaaag gattcagtta tgatcatcac actgttccaa gatatgttga accaccaaag
     1201 ccagttgtct actctttgtc tgccaataaa tcattggctc gttctgcatc agttccacgt
     1261 tcatctgctc cacctgagca acgagatgtt tggaatattc aacaatcgga agttgataag
     1321 gagacctaca tcactgagcc aaattggcgc cgaaatgtgg atcaacgtcg tcttgcgtgg
     1381 gaacgacgtg cttttgaaac cgagcaacat ttgagccgcc cgtattctga aaaggtggcg
     1441 cctggcgtgc ctccggcctg gcatgcagag gcacaacaca agcatcagca gtggcagcag
     1501 caggcggata atatgaacac tcaaaactac acctactcaa caactggata ccagccatcc
     1561 caaccatcgg gtggtcaaca atcatacaat gagaccagac aatactcatc caatgctact
     1621 tccaattatc catcacaaac tcaacaatat cagcaacaac aacatcaata tcaatcggat
     1681 cattcgaatg ctcaacgtct cttgaactct ggttacaaca cgaaccaagt agactatgta
     1741 ctcggtcaca aggacaagta caacgaggga ccacattatc aaccaccaat tattaattca
     1801 tcagctactg ctgcaaacaa ttcgtcatcc tcaacccatc actacaactc ttcatctcaa
     1861 gcaatcccac ttggaggacc aaatcaagga cactcttcgt cctcttacac tactgagaca
     1921 agagttactg gaggaggaac tggagcccca gtaagcaaca actacagtaa ccagaactat
     1981 tcttcatctg cttataactc ccagtcttct caacatcaga caaaatcgat tcctgttcag
     2041 aattatcaga tatccttccc gccactttct gtttctactc cagcttttgg cacttcattt
     2101 ttcgagaatt ctcaaaaatc tttccaagaa tccagtgaaa agttccatcg tgatttggct
     2161 tctccacttt ctagaactat tccagttcaa tctgccgggc atttttctga agtttctaaa
     2221 tatttcaatt cggaagagac aaatcatgaa tcccgtcaag agtctcggtg tcatagtgaa
     2281 gttgctgaaa ctactgaaac ttcagagaaa aaggaggaga actatcaagt ttctcaacca
     2341 gctattccat tgccatcagc tgatcaggtt tatgagagct ccaactacaa caagagctac
     2401 tcaagccaaa ctaccactca acaccaacca cagccagttg ctgctaacaa caactactcg
     2461 actagctatc ataccgagag atcttctacg acaactgctc aacaaccaca aacaattgct
     2521 cttccaccac cacagaacaa ttcaagccat accgagactc acagctccac tgggccaatc
     2581 atgatgcatt ctccaggagg tcattcaatg aagagcactg aattctcatc aagccgccat
     2641 cacaaacagg agactacaac aactacaaca acaactcctc agcctccagt attccaaact
     2701 acaacctatc caacgaccaa aactacttca tacaattatt cttcgagcac catcccatcg
     2761 cagccagcca aaccatcgtt caaccaggaa agctatacaa ctcacacaga gagaaacaat
     2821 tcttcgcaag gattcccaca acaaagactt caaccatccg gtggatattc ttacgaaaac
     2881 tattccagca gcagaaagga agagaaccgc cgtgaagaga cctcccgtcc agtttctcaa
     2941 ctttctcagt attcggaatc ccgtaactat aagagaaatt acgaggagaa gactgaaact
     3001 acaacagttc catctcttgc accagcaacc aatgtcacct ataaagactt atcaaatgct
     3061 caatgtgtag atgatgtttt caataagaag actgaaatga atgagtctct tccagttgga
     3121 tccgttttca atactcataa taatactgag ggaggctacc gtgatgcaaa tggacatgat
     3181 gtatcttaca aaagagaaac tcaaacatca gctgatccag gaagagagac agctcttcta
     3241 aaagaggaag agaaacgagt tgttgaaact ccattggagc caggagtcat ctctcgtcac
     3301 gtcactacca agtattacaa gaagaaaact gtcactgata caaccaccac tactgcctaa
//