Dbfetch

LOCUS       NM_001306876            3234 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Prion-like-(Q/N-rich)-domain-bearing protein
            (pqn-22), partial mRNA.
ACCESSION   NM_001306876
VERSION     NM_001306876.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3234)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3234)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3234)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3234)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3234
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>3234
                     /gene="pqn-22"
                     /locus_tag="CELE_C46G7.4"
                     /db_xref="GeneID:177369"
                     /db_xref="WormBase:WBGene00004112"
     CDS             1..3234
                     /gene="pqn-22"
                     /locus_tag="CELE_C46G7.4"
                     /standard_name="C46G7.4p"
                     /note="Product from WormBase gene class pqn;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Prion-like-(Q/N-rich)-domain-bearing protein"
                     /protein_id="NP_001293805.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004112"
                     /db_xref="GeneID:177369"
                     /db_xref="InterPro:IPR006643"
                     /db_xref="UniProtKB/TrEMBL:V6CJD2"
                     /db_xref="WormBase:WBGene00004112"
                     /translation="MTEVCGVNVPPAIAPLFSLPQSSIDDIQNTSLNSIRSSHPFSYT
                     KPTPGGPKLHNRIKCPRVVPRSFWLSFEEDEELDVPLLEPEMPQTVHLQYNSPMGLYS
                     KEAAVEQFQQQIGETPNDLPAQEKHFDPSKSATLKYLKEGERENFGENFFEKVAQAEA
                     PRVPYQSEPNWARTAREKSERARSKTPADPHTAYRPASSPAPANHPVHAENAREHAEK
                     SKVFTHNINEPFGRSYWEASNTVPRYGRSHSVGRELYNRGYELGGMDYTGGIHVDHGT
                     DYQYYEEPARKPQTPKLPPGYELGGTDFYKGHVPGDANYRGHGPDPPRLRPKYTADSH
                     DPCNVAIAPNLEGVDANLLVGDTLSNQKIRHEVRHIDQTKFGTSFGPTKGFSYDHHTV
                     PRYVEPPKPVVYSLSANKSLARSASVPRSSAPPEQRDVWNIQQSEVDKEVNIRTLLTD
                     EALRAPKREQSPYWAGHSEQKHEAWRGRTDPRLQRYETYITEPNWRRNVDQRRLAWER
                     RAFETEQHLSRPYSEKVAPGVPPAWHAEAQHKHQQWQQQADNMNTQNYTYSTTGYQPS
                     QPSGGQQSYNETRQYSSNATSNYPSQTQQYQQQQHQYQSDHSNAQRLLNSGYNTNQVD
                     YVLGHKDKYNEGPHYQPPIINSSATAANNSSSSTHHYNSSSQAIPLGGPNQGHSSSSY
                     TTETRVTGGGTGAPVSNNYSNQNYSSSAYNSQSSQHQTKSIPVQNYQEENYQVSQPAI
                     PLPSADQVYESSNYNKSYSSQTTTQHQPQPVAANNNYSTSYHTERSSTTTAQQPQTIA
                     LPPPQNNSSHTETHSSTGPIMMHSPGGHSMKSTEFSSSRHHKQETTTTTTTTPQPPVF
                     QTTTYPTTKTTSYNYSSSTIPSQPAKPSFNQESYTTHTERNNSSQGFPQQRLQPSGGY
                     SYENYSSSRKEENRREETSRPVSQLSQYSESRNYKRNYEEKTETTTVPSLAPATNVTY
                     KDLSNAQCVDDVFNKKTEMNESLPVGSVFNTHNNTEGGYRDANGHDVSYKRETQTSAD
                     PGRETALLKEEEKRVVETPLEPGVISRHVTTKYYKKKTVTDTTTTTA"
ORIGIN      
        1 atgacagaag tgtgtggagt gaatgtgcca ccggcaatag ctccattgtt ttcgttacct
       61 caatcatcaa ttgatgatat tcaaaatact tccctaaatt caattcgaag tagccatccg
      121 ttctcttaca cgaaaccaac acctggagga ccaaaacttc ataatcggat caaatgtcca
      181 agggtagttc cacgttcatt ctggttatcg tttgaagagg acgaggagct cgacgtccca
      241 ttacttgaac cggaaatgcc acaaactgta catcttcagt acaactcgcc aatgggattg
      301 tattccaagg aggccgcagt cgaacagttc caacaacaaa ttggagaaac cccaaatgac
      361 ttgcctgctc aggaaaaaca ctttgatccc tccaaaagtg caactttgaa gtacttgaag
      421 gaaggcgaac gagaaaactt tggcgaaaac tttttcgaaa aagtggctca agccgaggct
      481 ccacgagtcc catatcaatc ggagccaaat tgggcacgca ctgcaagaga gaaaagcgaa
      541 cgagcacgaa gcaagactcc agctgatcca cacacagctt atcgtccagc aagttcacct
      601 gcaccagcca atcatccagt acatgctgaa aatgctcgtg agcacgctga aaaaagcaaa
      661 gtattcacac ataatataaa tgaaccattt ggaagatctt attgggaagc aagtaatact
      721 gttccaagat atggtagaag ccattctgtt ggacgtgaac tttataatag aggctatgaa
      781 ttaggaggaa tggattatac tggtggaatc cacgtggatc atggaactga ttatcaatat
      841 tatgaagaac cggctagaaa accacagaca ccaaaactac cacctggcta tgaattggga
      901 ggtactgatt tctataaagg acacgttcct ggtgatgcaa actatcgtgg acacggacca
      961 gatccaccaa gacttcgtcc gaagtatact gcggattctc atgatccatg taatgttgct
     1021 atagcaccga atttggaagg ggttgacgca aatttactcg tcggtgatac cctctcaaat
     1081 caaaagatcc gtcatgaagt ccgtcacatt gaccaaacga aattcggaac atcatttgga
     1141 ccaactaaag gattcagtta tgatcatcac actgttccaa gatatgttga accaccaaag
     1201 ccagttgtct actctttgtc tgccaataaa tcattggctc gttctgcatc agttccacgt
     1261 tcatctgctc cacctgagca acgagatgtt tggaatattc aacaatcgga agttgataag
     1321 gaggtgaaca ttcgaacact tctgaccgac gaggctcttc gagcaccaaa acgagagcag
     1381 tcaccgtatt gggcgggtca ttctgaacag aaacatgaag catggagagg aagaactgat
     1441 ccaagacttc aaagatatga gacctacatc actgagccaa attggcgccg aaatgtggat
     1501 caacgtcgtc ttgcgtggga acgacgtgct tttgaaaccg agcaacattt gagccgcccg
     1561 tattctgaaa aggtggcgcc tggcgtgcct ccggcctggc atgcagaggc acaacacaag
     1621 catcagcagt ggcagcagca ggcggataat atgaacactc aaaactacac ctactcaaca
     1681 actggatacc agccatccca accatcgggt ggtcaacaat catacaatga gaccagacaa
     1741 tactcatcca atgctacttc caattatcca tcacaaactc aacaatatca gcaacaacaa
     1801 catcaatatc aatcggatca ttcgaatgct caacgtctct tgaactctgg ttacaacacg
     1861 aaccaagtag actatgtact cggtcacaag gacaagtaca acgagggacc acattatcaa
     1921 ccaccaatta ttaattcatc agctactgct gcaaacaatt cgtcatcctc aacccatcac
     1981 tacaactctt catctcaagc aatcccactt ggaggaccaa atcaaggaca ctcttcgtcc
     2041 tcttacacta ctgagacaag agttactgga ggaggaactg gagccccagt aagcaacaac
     2101 tacagtaacc agaactattc ttcatctgct tataactccc agtcttctca acatcagaca
     2161 aaatcgattc ctgttcagaa ttatcaggag gagaactatc aagtttctca accagctatt
     2221 ccattgccat cagctgatca ggtttatgag agctccaact acaacaagag ctactcaagc
     2281 caaactacca ctcaacacca accacagcca gttgctgcta acaacaacta ctcgactagc
     2341 tatcataccg agagatcttc tacgacaact gctcaacaac cacaaacaat tgctcttcca
     2401 ccaccacaga acaattcaag ccataccgag actcacagct ccactgggcc aatcatgatg
     2461 cattctccag gaggtcattc aatgaagagc actgaattct catcaagccg ccatcacaaa
     2521 caggagacta caacaactac aacaacaact cctcagcctc cagtattcca aactacaacc
     2581 tatccaacga ccaaaactac ttcatacaat tattcttcga gcaccatccc atcgcagcca
     2641 gccaaaccat cgttcaacca ggaaagctat acaactcaca cagagagaaa caattcttcg
     2701 caaggattcc cacaacaaag acttcaacca tccggtggat attcttacga aaactattcc
     2761 agcagcagaa aggaagagaa ccgccgtgaa gagacctccc gtccagtttc tcaactttct
     2821 cagtattcgg aatcccgtaa ctataagaga aattacgagg agaagactga aactacaaca
     2881 gttccatctc ttgcaccagc aaccaatgtc acctataaag acttatcaaa tgctcaatgt
     2941 gtagatgatg ttttcaataa gaagactgaa atgaatgagt ctcttccagt tggatccgtt
     3001 ttcaatactc ataataatac tgagggaggc taccgtgatg caaatggaca tgatgtatct
     3061 tacaaaagag aaactcaaac atcagctgat ccaggaagag agacagctct tctaaaagag
     3121 gaagagaaac gagttgttga aactccattg gagccaggag tcatctctcg tcacgtcact
     3181 accaagtatt acaagaagaa aactgtcact gatacaacca ccactactgc ctaa
//