Dbfetch

LOCUS       NM_001306868            3186 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Prion-like-(Q/N-rich)-domain-bearing protein
            (pqn-22), partial mRNA.
ACCESSION   NM_001306868
VERSION     NM_001306868.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3186)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3186)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3186)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3186)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3186
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>3186
                     /gene="pqn-22"
                     /locus_tag="CELE_C46G7.4"
                     /db_xref="GeneID:177369"
                     /db_xref="WormBase:WBGene00004112"
     CDS             1..3186
                     /gene="pqn-22"
                     /locus_tag="CELE_C46G7.4"
                     /standard_name="C46G7.4h"
                     /note="Product from WormBase gene class pqn;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Prion-like-(Q/N-rich)-domain-bearing protein"
                     /protein_id="NP_001293797.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004112"
                     /db_xref="EnsemblGenomes-Tr:C46G7.4h"
                     /db_xref="GeneID:177369"
                     /db_xref="InterPro:IPR006643"
                     /db_xref="UniProtKB/TrEMBL:V6CLV0"
                     /db_xref="WormBase:WBGene00004112"
                     /translation="MPQTVHLQYNSPMGLYSKEAAVEQFQQQIGETPNDLPAQEKHFD
                     PSKSATLKYLKEGERENFGENFFEKVAQAEAPRVPYQSEPNWARTAREKSERARSKTP
                     ADPHTAYRPASSPAPANHPVHAENAREHAEKSKVFTHNINEPFGRSYWEASNTVPRYG
                     RSHSVGRELYNRGYELGGMDYTGGIHVDHGTDYQYYEEPARKPQTPKLPPGYELGGTD
                     FYKGHVPGDANYRGHGPDPPRLRPKYTADSHDPCNVAIAPNLEGVDANLLVGDTLSNQ
                     KIRHEVRHIDQTKFGTSFGPTKGFSYDHHTVPRYVEPPKPVVYSLSANKSLARSASVP
                     RSSAPPEQRDVWNIQQSEVDKEVNIRTLLTDEALRAPKREQSPYWAGHSEQKHEAWRG
                     RTDPRLQRYETYITEPNWRRNVDQRRLAWERRAFETEQHLSRPYSEKVAPGVPPAWHA
                     EAQHKHQQWQQQADNMNTQNYTYSTTGYQPSQPSGGQQSYNETRQYSSNATSNYPSQT
                     QQYQQQQHQYQSDHSNAQRLLNSGYNTNQVDYVLGHKDKYNEGPHYQPPIINSSATAA
                     NNSSSSTHHYNSSSQAIPLGGPNQGHSSSSYTTETRVTGGGTGAPVSNNYSNQNYSSS
                     AYNSQSSQHQTKSIPVQNYQNSQKSFQESSEKFHRDLASPLSRTIPVQSAGHFSEVSK
                     YFNSEETNHESRQESRCHSEVAETTETSEKKEENYQVSQPAIPLPSADQVYESSNYNK
                     SYSSQTTTQHQPQPVAANNNYSTSYHTERSSTTTAQQPQTIALPPPQNNSSHTETHSS
                     TGPIMMHSPGGHSMKSTEFSSSRHHKQETTTTTTTTPQPPVFQTTTYPTTKTTSYNYS
                     SSTIPSQPAKPSFNQESYTTHTERNNSSQGFPQQRLQPSGGYSYENYSSSRKEENRRE
                     ETSRPVSQLSQYSESRNYKRNYEEKTETTTVPSLAPATNVTYKDLSNAQCVDDVFNKK
                     TEMNESLPVGSVFNTHNNTEGGYRDANGHDVSYKRETQTSADPGRETALLKEEEKRVV
                     ETPLEPGVISRHVTTKYYKKKTVTDTTTTTA"
ORIGIN      
        1 atgccacaaa ctgtacatct tcagtacaac tcgccaatgg gattgtattc caaggaggcc
       61 gcagtcgaac agttccaaca acaaattgga gaaaccccaa atgacttgcc tgctcaggaa
      121 aaacactttg atccctccaa aagtgcaact ttgaagtact tgaaggaagg cgaacgagaa
      181 aactttggcg aaaacttttt cgaaaaagtg gctcaagccg aggctccacg agtcccatat
      241 caatcggagc caaattgggc acgcactgca agagagaaaa gcgaacgagc acgaagcaag
      301 actccagctg atccacacac agcttatcgt ccagcaagtt cacctgcacc agccaatcat
      361 ccagtacatg ctgaaaatgc tcgtgagcac gctgaaaaaa gcaaagtatt cacacataat
      421 ataaatgaac catttggaag atcttattgg gaagcaagta atactgttcc aagatatggt
      481 agaagccatt ctgttggacg tgaactttat aatagaggct atgaattagg aggaatggat
      541 tatactggtg gaatccacgt ggatcatgga actgattatc aatattatga agaaccggct
      601 agaaaaccac agacaccaaa actaccacct ggctatgaat tgggaggtac tgatttctat
      661 aaaggacacg ttcctggtga tgcaaactat cgtggacacg gaccagatcc accaagactt
      721 cgtccgaagt atactgcgga ttctcatgat ccatgtaatg ttgctatagc accgaatttg
      781 gaaggggttg acgcaaattt actcgtcggt gataccctct caaatcaaaa gatccgtcat
      841 gaagtccgtc acattgacca aacgaaattc ggaacatcat ttggaccaac taaaggattc
      901 agttatgatc atcacactgt tccaagatat gttgaaccac caaagccagt tgtctactct
      961 ttgtctgcca ataaatcatt ggctcgttct gcatcagttc cacgttcatc tgctccacct
     1021 gagcaacgag atgtttggaa tattcaacaa tcggaagttg ataaggaggt gaacattcga
     1081 acacttctga ccgacgaggc tcttcgagca ccaaaacgag agcagtcacc gtattgggcg
     1141 ggtcattctg aacagaaaca tgaagcatgg agaggaagaa ctgatccaag acttcaaaga
     1201 tatgagacct acatcactga gccaaattgg cgccgaaatg tggatcaacg tcgtcttgcg
     1261 tgggaacgac gtgcttttga aaccgagcaa catttgagcc gcccgtattc tgaaaaggtg
     1321 gcgcctggcg tgcctccggc ctggcatgca gaggcacaac acaagcatca gcagtggcag
     1381 cagcaggcgg ataatatgaa cactcaaaac tacacctact caacaactgg ataccagcca
     1441 tcccaaccat cgggtggtca acaatcatac aatgagacca gacaatactc atccaatgct
     1501 acttccaatt atccatcaca aactcaacaa tatcagcaac aacaacatca atatcaatcg
     1561 gatcattcga atgctcaacg tctcttgaac tctggttaca acacgaacca agtagactat
     1621 gtactcggtc acaaggacaa gtacaacgag ggaccacatt atcaaccacc aattattaat
     1681 tcatcagcta ctgctgcaaa caattcgtca tcctcaaccc atcactacaa ctcttcatct
     1741 caagcaatcc cacttggagg accaaatcaa ggacactctt cgtcctctta cactactgag
     1801 acaagagtta ctggaggagg aactggagcc ccagtaagca acaactacag taaccagaac
     1861 tattcttcat ctgcttataa ctcccagtct tctcaacatc agacaaaatc gattcctgtt
     1921 cagaattatc agaattctca aaaatctttc caagaatcca gtgaaaagtt ccatcgtgat
     1981 ttggcttctc cactttctag aactattcca gttcaatctg ccgggcattt ttctgaagtt
     2041 tctaaatatt tcaattcgga agagacaaat catgaatccc gtcaagagtc tcggtgtcat
     2101 agtgaagttg ctgaaactac tgaaacttca gagaaaaagg aggagaacta tcaagtttct
     2161 caaccagcta ttccattgcc atcagctgat caggtttatg agagctccaa ctacaacaag
     2221 agctactcaa gccaaactac cactcaacac caaccacagc cagttgctgc taacaacaac
     2281 tactcgacta gctatcatac cgagagatct tctacgacaa ctgctcaaca accacaaaca
     2341 attgctcttc caccaccaca gaacaattca agccataccg agactcacag ctccactggg
     2401 ccaatcatga tgcattctcc aggaggtcat tcaatgaaga gcactgaatt ctcatcaagc
     2461 cgccatcaca aacaggagac tacaacaact acaacaacaa ctcctcagcc tccagtattc
     2521 caaactacaa cctatccaac gaccaaaact acttcataca attattcttc gagcaccatc
     2581 ccatcgcagc cagccaaacc atcgttcaac caggaaagct atacaactca cacagagaga
     2641 aacaattctt cgcaaggatt cccacaacaa agacttcaac catccggtgg atattcttac
     2701 gaaaactatt ccagcagcag aaaggaagag aaccgccgtg aagagacctc ccgtccagtt
     2761 tctcaacttt ctcagtattc ggaatcccgt aactataaga gaaattacga ggagaagact
     2821 gaaactacaa cagttccatc tcttgcacca gcaaccaatg tcacctataa agacttatca
     2881 aatgctcaat gtgtagatga tgttttcaat aagaagactg aaatgaatga gtctcttcca
     2941 gttggatccg ttttcaatac tcataataat actgagggag gctaccgtga tgcaaatgga
     3001 catgatgtat cttacaaaag agaaactcaa acatcagctg atccaggaag agagacagct
     3061 cttctaaaag aggaagagaa acgagttgtt gaaactccat tggagccagg agtcatctct
     3121 cgtcacgtca ctaccaagta ttacaagaag aaaactgtca ctgatacaac caccactact
     3181 gcctaa
//