Dbfetch

LOCUS       NM_001306865            1584 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Prion-like-(Q/N-rich)-domain-bearing protein
            (pqn-22), partial mRNA.
ACCESSION   NM_001306865
VERSION     NM_001306865.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1584)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1584)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1584)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1584)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1584
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>1584
                     /gene="pqn-22"
                     /locus_tag="CELE_C46G7.4"
                     /db_xref="GeneID:177369"
                     /db_xref="WormBase:WBGene00004112"
     CDS             1..1584
                     /gene="pqn-22"
                     /locus_tag="CELE_C46G7.4"
                     /standard_name="C46G7.4e"
                     /note="Product from WormBase gene class pqn;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Prion-like-(Q/N-rich)-domain-bearing protein"
                     /protein_id="NP_001293794.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004112"
                     /db_xref="EnsemblGenomes-Tr:C46G7.4e"
                     /db_xref="GeneID:177369"
                     /db_xref="UniProtKB/TrEMBL:V6CLP8"
                     /db_xref="WormBase:WBGene00004112"
                     /translation="MNTQNYTYSTTGYQPSQPSGGQQSYNETRQYSSNATSNYPSQTQ
                     QYQQQQHQYQSDHSNAQRLLNSGYNTNQVDYVLGHKDKYNEGPHYQPPIINSSATAAN
                     NSSSSTHHYNSSSQAIPLGGPNQGHSSSSYTTETRVTGGGTGAPVSNNYSNQNYSSSA
                     YNSQSSQHQTKSIPVQNYQEENYQVSQPAIPLPSADQVYESSNYNKSYSSQTTTQHQP
                     QPVAANNNYSTSYHTERSSTTTAQQPQTIALPPPQNNSSHTETHSSTGPIMMHSPGGH
                     SMKSTEFSSSRHHKQETTTTTTTTPQPPVFQTTTYPTTKTTSYNYSSSTIPSQPAKPS
                     FNQESYTTHTERNNSSQGFPQQRLQPSGGYSYENYSSSRKEENRREETSRPVSQLSQY
                     SESRNYKRNYEEKTETTTVPSLAPATNVTYKDLSNAQCVDDVFNKKTEMNESLPVGSV
                     FNTHNNTEGGYRDANGHDVSYKRETQTSADPGRETALLKEEEKRVVETPLEPGVISRH
                     VTTKYYKKKTVTDTTTTTA"
ORIGIN      
        1 atgaacactc aaaactacac ctactcaaca actggatacc agccatccca accatcgggt
       61 ggtcaacaat catacaatga gaccagacaa tactcatcca atgctacttc caattatcca
      121 tcacaaactc aacaatatca gcaacaacaa catcaatatc aatcggatca ttcgaatgct
      181 caacgtctct tgaactctgg ttacaacacg aaccaagtag actatgtact cggtcacaag
      241 gacaagtaca acgagggacc acattatcaa ccaccaatta ttaattcatc agctactgct
      301 gcaaacaatt cgtcatcctc aacccatcac tacaactctt catctcaagc aatcccactt
      361 ggaggaccaa atcaaggaca ctcttcgtcc tcttacacta ctgagacaag agttactgga
      421 ggaggaactg gagccccagt aagcaacaac tacagtaacc agaactattc ttcatctgct
      481 tataactccc agtcttctca acatcagaca aaatcgattc ctgttcagaa ttatcaggag
      541 gagaactatc aagtttctca accagctatt ccattgccat cagctgatca ggtttatgag
      601 agctccaact acaacaagag ctactcaagc caaactacca ctcaacacca accacagcca
      661 gttgctgcta acaacaacta ctcgactagc tatcataccg agagatcttc tacgacaact
      721 gctcaacaac cacaaacaat tgctcttcca ccaccacaga acaattcaag ccataccgag
      781 actcacagct ccactgggcc aatcatgatg cattctccag gaggtcattc aatgaagagc
      841 actgaattct catcaagccg ccatcacaaa caggagacta caacaactac aacaacaact
      901 cctcagcctc cagtattcca aactacaacc tatccaacga ccaaaactac ttcatacaat
      961 tattcttcga gcaccatccc atcgcagcca gccaaaccat cgttcaacca ggaaagctat
     1021 acaactcaca cagagagaaa caattcttcg caaggattcc cacaacaaag acttcaacca
     1081 tccggtggat attcttacga aaactattcc agcagcagaa aggaagagaa ccgccgtgaa
     1141 gagacctccc gtccagtttc tcaactttct cagtattcgg aatcccgtaa ctataagaga
     1201 aattacgagg agaagactga aactacaaca gttccatctc ttgcaccagc aaccaatgtc
     1261 acctataaag acttatcaaa tgctcaatgt gtagatgatg ttttcaataa gaagactgaa
     1321 atgaatgagt ctcttccagt tggatccgtt ttcaatactc ataataatac tgagggaggc
     1381 taccgtgatg caaatggaca tgatgtatct tacaaaagag aaactcaaac atcagctgat
     1441 ccaggaagag agacagctct tctaaaagag gaagagaaac gagttgttga aactccattg
     1501 gagccaggag tcatctctcg tcacgtcact accaagtatt acaagaagaa aactgtcact
     1561 gatacaacca ccactactgc ctaa
//