Dbfetch

LOCUS       NM_001306864            1791 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Prion-like-(Q/N-rich)-domain-bearing protein
            (pqn-22), partial mRNA.
ACCESSION   NM_001306864
VERSION     NM_001306864.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1791)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1791)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1791)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1791)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1791
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>1791
                     /gene="pqn-22"
                     /locus_tag="CELE_C46G7.4"
                     /db_xref="GeneID:177369"
                     /db_xref="WormBase:WBGene00004112"
     CDS             1..1791
                     /gene="pqn-22"
                     /locus_tag="CELE_C46G7.4"
                     /standard_name="C46G7.4d"
                     /note="Product from WormBase gene class pqn;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Prion-like-(Q/N-rich)-domain-bearing protein"
                     /protein_id="NP_001293793.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004112"
                     /db_xref="EnsemblGenomes-Tr:C46G7.4d"
                     /db_xref="GeneID:177369"
                     /db_xref="UniProtKB/TrEMBL:V6CLT8"
                     /db_xref="WormBase:WBGene00004112"
                     /translation="MNTQNYTYSTTGYQPSQPSGGQQSYNETRQYSSNATSNYPSQTQ
                     QYQQQQHQYQSDHSNAQRLLNSGYNTNQVDYVLGHKDKYNEGPHYQPPIINSSATAAN
                     NSSSSTHHYNSSSQAIPLGGPNQGHSSSSYTTETRVTGGGTGAPVSNNYSNQNYSSSA
                     YNSQSSQHQTKSIPVQNYQNSQKSFQESSEKFHRDLASPLSRTIPVQSAGHFSEVSKY
                     FNSEETNHESRQESRCHSEVAETTETSEKKEENYQVSQPAIPLPSADQVYESSNYNKS
                     YSSQTTTQHQPQPVAANNNYSTSYHTERSSTTTAQQPQTIALPPPQNNSSHTETHSST
                     GPIMMHSPGGHSMKSTEFSSSRHHKQETTTTTTTTPQPPVFQTTTYPTTKTTSYNYSS
                     STIPSQPAKPSFNQESYTTHTERNNSSQGFPQQRLQPSGGYSYENYSSSRKEENRREE
                     TSRPVSQLSQYSESRNYKRNYEEKTETTTVPSLAPATNVTYKDLSNAQCVDDVFNKKT
                     EMNESLPVGSVFNTHNNTEGGYRDANGHDVSYKRETQTSADPGRETALLKEEEKRVVE
                     TPLEPGVISRHVTTKYYKKKTVTDTTTTTA"
ORIGIN      
        1 atgaacactc aaaactacac ctactcaaca actggatacc agccatccca accatcgggt
       61 ggtcaacaat catacaatga gaccagacaa tactcatcca atgctacttc caattatcca
      121 tcacaaactc aacaatatca gcaacaacaa catcaatatc aatcggatca ttcgaatgct
      181 caacgtctct tgaactctgg ttacaacacg aaccaagtag actatgtact cggtcacaag
      241 gacaagtaca acgagggacc acattatcaa ccaccaatta ttaattcatc agctactgct
      301 gcaaacaatt cgtcatcctc aacccatcac tacaactctt catctcaagc aatcccactt
      361 ggaggaccaa atcaaggaca ctcttcgtcc tcttacacta ctgagacaag agttactgga
      421 ggaggaactg gagccccagt aagcaacaac tacagtaacc agaactattc ttcatctgct
      481 tataactccc agtcttctca acatcagaca aaatcgattc ctgttcagaa ttatcagaat
      541 tctcaaaaat ctttccaaga atccagtgaa aagttccatc gtgatttggc ttctccactt
      601 tctagaacta ttccagttca atctgccggg catttttctg aagtttctaa atatttcaat
      661 tcggaagaga caaatcatga atcccgtcaa gagtctcggt gtcatagtga agttgctgaa
      721 actactgaaa cttcagagaa aaaggaggag aactatcaag tttctcaacc agctattcca
      781 ttgccatcag ctgatcaggt ttatgagagc tccaactaca acaagagcta ctcaagccaa
      841 actaccactc aacaccaacc acagccagtt gctgctaaca acaactactc gactagctat
      901 cataccgaga gatcttctac gacaactgct caacaaccac aaacaattgc tcttccacca
      961 ccacagaaca attcaagcca taccgagact cacagctcca ctgggccaat catgatgcat
     1021 tctccaggag gtcattcaat gaagagcact gaattctcat caagccgcca tcacaaacag
     1081 gagactacaa caactacaac aacaactcct cagcctccag tattccaaac tacaacctat
     1141 ccaacgacca aaactacttc atacaattat tcttcgagca ccatcccatc gcagccagcc
     1201 aaaccatcgt tcaaccagga aagctataca actcacacag agagaaacaa ttcttcgcaa
     1261 ggattcccac aacaaagact tcaaccatcc ggtggatatt cttacgaaaa ctattccagc
     1321 agcagaaagg aagagaaccg ccgtgaagag acctcccgtc cagtttctca actttctcag
     1381 tattcggaat cccgtaacta taagagaaat tacgaggaga agactgaaac tacaacagtt
     1441 ccatctcttg caccagcaac caatgtcacc tataaagact tatcaaatgc tcaatgtgta
     1501 gatgatgttt tcaataagaa gactgaaatg aatgagtctc ttccagttgg atccgttttc
     1561 aatactcata ataatactga gggaggctac cgtgatgcaa atggacatga tgtatcttac
     1621 aaaagagaaa ctcaaacatc agctgatcca ggaagagaga cagctcttct aaaagaggaa
     1681 gagaaacgag ttgttgaaac tccattggag ccaggagtca tctctcgtca cgtcactacc
     1741 aagtattaca agaagaaaac tgtcactgat acaaccacca ctactgccta a
//