Dbfetch

LOCUS       NM_001306820            2844 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Netrin receptor unc-5 (unc-5), partial mRNA.
ACCESSION   NM_001306820
VERSION     NM_001306820.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 2844)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 2844)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2844)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 2844)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..2844
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>2844
                     /gene="unc-5"
                     /locus_tag="CELE_B0273.4"
                     /db_xref="GeneID:177334"
                     /db_xref="WormBase:WBGene00006745"
     CDS             1..2844
                     /gene="unc-5"
                     /locus_tag="CELE_B0273.4"
                     /standard_name="B0273.4c"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Netrin receptor unc-5"
                     /protein_id="NP_001293749.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006745"
                     /db_xref="GeneID:177334"
                     /db_xref="GOA:V6CK86"
                     /db_xref="InterPro:IPR000488"
                     /db_xref="InterPro:IPR000884"
                     /db_xref="InterPro:IPR000906"
                     /db_xref="InterPro:IPR003598"
                     /db_xref="InterPro:IPR003599"
                     /db_xref="InterPro:IPR007110"
                     /db_xref="InterPro:IPR011029"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR033772"
                     /db_xref="InterPro:IPR036179"
                     /db_xref="InterPro:IPR036383"
                     /db_xref="InterPro:IPR037936"
                     /db_xref="UniProtKB/TrEMBL:V6CK86"
                     /db_xref="WormBase:WBGene00006745"
                     /translation="MEDDTPDVSSDSNGDAAYSDYFLDYKSIMDEITITTQPKSGYVI
                     RNKPLRLQCRANHATKIRYKCSSKWIDDSRIEKLIGTDSTSGVGYIDASVDISRIDVD
                     TSGHVDAFQCQCYASGDDDQDVVASDVATVHLAYMRKHFLKSPVAQRVQEGTTLQLPC
                     QAPESDPKAELTWYKDGVVVQPDANVIRASDGSLIMSAARLSDSGNYTCEATNVANSR
                     KTDPVEVQIYVDGGWSEWSPWIGTCHVDCPLLRQHAHRIRDPHDVLPHQRRTRTCNNP
                     APLNDGEYCKGEEEMTRSCKVPCKLDGGWSSWSDWSACSSSCHRYRTRACTVPPPMNG
                     GQPCFGDDLMTQECPAQLCTADSSRIVISDTAVYGSVASIFIVASFILAILAMFCCKR
                     GNSKKSKPLKPQKMNSEKAGGIYYSEPPGVRRLLLEHQHGTLLGEKISSCSQYFEPPP
                     LPHSTTLRSGKSAFSGYSSTRNAGSRAALIQECSSSSSGSGGKRTMLRTSSSNCSDDD
                     NYATLYDYMEDKSVLGLDTSQNIVAAQIDSNGARLSLSKSGARLIVPELAVEGEKMLY
                     LAVSDTLTDQPHLKPIESALSPVIVIGQCDVSMSAHDNILRRPVVVSFRHCASTFPRD
                     NWQFTLYADEGSGWQKAVTIGEENLNTNMFVQFEQPGKKNDGFGWCHVMTYSLARLML
                     AGHPRRNSLSAAKRVHLAVFGPTEMSAYRRPFELRVYCVPETGAAMESVWKQEDGSRL
                     LCESNDFILNEKGNLCICIEDVIPGFSCDGPEVVEISETQHRFVAQNGLHCSLKFRPK
                     EINGSQFSTRVIVYQKASSTEPMVMEVSNEPELYDATSEEREKGSVCVEFRLPFGVKD
                     ELARLLDMPNESHSDWRGLAKKLHYDRYLQFFASFPDCSPTSLLLDLWEASSSGSARA
                     VPDLLQTLRVMGRPDAVMVLERFLSAFPQIVSP"
ORIGIN      
        1 atggaggacg acacgcccga tgtgagttca gattccaatg gagatgcagc atacagcgat
       61 tatttcttgg actacaaatc aataatggac gaaatcacaa tcacaacaca accaaaatcc
      121 ggttatgtca ttcgaaataa gccattgcgt cttcaatgcc gagccaatca cgcaacaaag
      181 attcgttaca aatgtagctc aaaatggatc gacgattctc gaatcgaaaa gcttatcgga
      241 accgactcga cgtctggagt tggatacatt gacgcttcag ttgatatttc tcgaatcgac
      301 gtagacacat ctggacacgt tgacgctttt cagtgtcagt gttacgcttc tggagacgac
      361 gatcaagacg ttgtggcttc tgacgtggcg acagttcatt tggcttatat gcggaagcac
      421 tttctcaaat cacccgttgc tcaacgggtt caagaaggca caaccctcca acttccctgt
      481 caagcaccgg aatcagatcc gaaagcagag ctcacctggt acaaagatgg agtcgttgta
      541 cagcctgatg caaatgttat ccgagcatct gatggaagtc taattatgtc agccgccaga
      601 ttatcagaca gtggaaatta tacatgtgaa gccacaaatg tggcgaattc gaggaaaact
      661 gacccagtgg aagtacagat ttatgttgac ggtggttggt ccgaatggtc cccgtggatc
      721 ggaacgtgtc acgtcgactg tccccttctc cgtcaacacg cccatcgaat ccgtgatccg
      781 catgacgttc tgccccatca gagaagaaca cgaacttgta ataatccagc tccattgaac
      841 gacggagagt actgtaaggg agaagaagaa atgacgagaa gctgtaaagt accatgtaaa
      901 cttgatggag gatggagttc atggagtgat tggagtgctt gctcttcgag ttgtcatcgg
      961 tataggacga gagcatgtac cgttccacct ccgatgaatg gaggacagcc atgttttgga
     1021 gatgatctga tgacacaaga gtgtccggca cagctttgca ctgcggactc ctctcggata
     1081 gtaatcagtg atactgctgt ttatggatca gttgcatcta ttttcattgt tgcctcattt
     1141 attcttgcaa ttcttgcaat gttctgctgt aaacgtggca attcaaaaaa gtcgaaacca
     1201 ttgaaaccgc agaaaatgaa ttcggaaaaa gcaggaggaa tctactattc tgagcctcca
     1261 ggtgttcgaa gattactttt ggagcatcaa catggaacat tgctcggaga gaaaatatca
     1321 tcgtgttctc aatattttga gcctcctcct ctaccacatt caacaactct tcgatctgga
     1381 aaaagtgcat tcagtggata ttcttcaaca agaaacgctg gctcacgagc tgctttaatt
     1441 caagaatgta gttcgagtag ttcaggatct ggtggaaaac ggacaatgct tagaacttca
     1501 agctcaaatt gctcggatga cgataattat gctacgttat atgattatat ggaagacaag
     1561 agtgttcttg gattagacac ttcacaaaat attgttgctg cgcagattga tagcaatgga
     1621 gcacgattgt ctttatcaaa aagtggagca agattaattg tacctgaatt ggcagtggaa
     1681 ggagagaaaa tgctttatct ggctgtttcg gacaccttaa cagatcaacc tcacctcaaa
     1741 ccaatcgaat ccgctctctc cccagtcatc gtcatcggac aatgtgatgt ttcaatgtca
     1801 gctcatgata atattctccg tcgtcctgtt gttgtatcct tccgtcattg tgcttcaact
     1861 tttccacgtg acaattggca attcacattg tatgctgatg aaggatccgg atggcagaag
     1921 gctgtaacaa ttggagaaga gaacttgaat accaacatgt ttgtacaatt cgagcaacct
     1981 gggaagaaga atgatggatt tggatggtgc cacgttatga catattcctt agcgaggtta
     2041 atgctagctg gtcatccgag gagaaattct ttgagtgctg caaaaagagt tcatttagct
     2101 gtatttggtc caactgaaat gtcagcttat cgaagaccat ttgaattgag agtttattgt
     2161 gttcctgaaa ctggagcagc aatggaaagt gtatggaaac aggaagatgg atctcgtcta
     2221 ctttgtgaat caaatgattt tattttaaat gaaaaaggaa atctttgcat ttgtattgaa
     2281 gatgttattc ctggattctc atgcgatggc cctgaagttg tggaaatctc ggaaacacaa
     2341 cacagatttg ttgctcaaaa tggccttcat tgctcattga aattccgacc aaaggaaatc
     2401 aacggctcac agttttcaac gagagtaatt gtctatcaaa aggcaagctc aacggagcca
     2461 atggtgatgg aagtgagcaa tgagccggag ctctatgatg caacaagtga agaaagagaa
     2521 aagggatccg tttgtgtaga gttccgattg ccatttggag tgaaggatga actggcaagg
     2581 cttttggata tgccaaatga atcacattct gattggagag gattggcaaa gaaattgcat
     2641 tacgatagat atttgcagtt cttcgcctca ttccctgatt gctctcccac atcacttctc
     2701 ctggatcttt gggaagcttc atcttctgga tcagctcgtg cagttccaga tcttcttcaa
     2761 actcttcgtg taatgggacg acccgatgca gtaatggtcc tggaacgatt tctatcagct
     2821 tttccacaaa ttgtgtcccc ataa
//