Dbfetch

LOCUS       NM_001306658            1419 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Transcription factor lin-26 (lin-26),
            partial mRNA.
ACCESSION   NM_001306658
VERSION     NM_001306658.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1419)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1419)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1419)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1419)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003280).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1419
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="II"
     gene            <1..>1419
                     /gene="lin-26"
                     /locus_tag="CELE_F18A1.2"
                     /db_xref="GeneID:3565051"
                     /db_xref="WormBase:WBGene00003012"
     CDS             1..1419
                     /gene="lin-26"
                     /locus_tag="CELE_F18A1.2"
                     /standard_name="F18A1.2c"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Transcription factor lin-26"
                     /protein_id="NP_001293587.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00003012"
                     /db_xref="GeneID:3565051"
                     /db_xref="UniProtKB/TrEMBL:U4PC59"
                     /db_xref="WormBase:WBGene00003012"
                     /translation="MILHGFHLSTSSHCLPFIFRHLFIFHSITALCDHMLSKFVVVEV
                     SNSNNTMTLVEYLVTHGFDKFAVVTDLVDHPSFKYKDGSSSPESPSTTASTAAQHTPP
                     RTAVSTPTSINTPVPPHQNKQRHSIDKIAANLSTKKVSPSSIEKQLQRTSHNPLHQLS
                     TPHALSQLQKLLEEQHKINQMNIQKKEQERQQAEIQRILLQQANAAQINHSFGLERLT
                     PEYDDNHHSETISKASSEDLKTEPDSTDFGLGTSDDQVRASMLHLLHPVFAPAFGMLD
                     AENIFGAASKPTTPASKRRNTDSNGAPSKKHRWLPVNELEESRSSRGKNCGRVHCKAT
                     YKCALCGKPTTLNSTGSRWNLLRHVIMIHSDCKPYKCWDCDFTGIKSNVISHARQCRH
                     NAEDAHDITTDEMRAEWNLRLHECFPDYVRAKERGWQPEEVTVKKEEVEESPTLVKQE
                     LTLVKQEPTFAEQLEPMAQPLV"
ORIGIN      
        1 atgattcttc atggctttca cttgtcgacg tcttcccatt gtcttccatt catctttcgt
       61 catctcttca tatttcactc aatcactgcc ttgtgcgatc atatgctttc taaatttgtg
      121 gtagtcgaag taagcaactc aaataacaca atgacactgg tggaatactt ggtaacgcat
      181 ggattcgaca agtttgcagt tgtaacagat ttagttgatc acccttcttt caagtacaag
      241 gatggttcat caagtcccga atctccatca acaactgctt caactgctgc ccaacacaca
      301 ccaccacgaa cagcagtttc aacacctaca tccatcaaca ctccagttcc accacatcaa
      361 aacaaacaga ggcattcaat tgacaaaatc gctgcaaatt tatccaccaa aaaggtttca
      421 ccatcatcta ttgagaagca gctccaaaga acatctcata atcctcttca tcaactatct
      481 accccacatg cattgagtca actacagaaa ttgctggagg agcagcacaa gattaatcag
      541 atgaatattc agaaaaagga acaggagagg cagcaagctg agattcaaag aattctgctc
      601 caacaggcaa atgctgctca gattaatcac tcatttggat tagaaaggct aacaccagaa
      661 tatgatgata atcatcatag tgaaacaata tctaaagcta gctctgaaga tttgaagact
      721 gagcccgatt caactgattt tgggcttgga acaagcgacg atcaagtacg tgcttcaatg
      781 cttcatctgc ttcatccagt atttgctcca gcttttggga tgcttgatgc cgagaatatc
      841 tttggagctg catcaaaacc aacgacgcct gcatcaaaac gacgaaacac tgattcaaat
      901 ggtgctccat cgaaaaaaca tcgttggctc ccagtcaatg agcttgaaga gagtcgatca
      961 tcgcgaggaa agaactgcgg aagagttcat tgcaaggcca cctacaagtg tgcactctgt
     1021 ggaaagccaa caacactcaa ctcaacagga tctcgttgga atcttctgcg ccacgtcatc
     1081 atgatccatt cggattgtaa gccatataag tgttgggatt gtgacttcac cggaataaaa
     1141 tccaacgtta tctcccacgc caggcaatgt cgtcacaacg ccgaagatgc ccatgacatt
     1201 actaccgacg agatgcgtgc cgaatggaat ctccgccttc acgaatgctt cccagattat
     1261 gtgcgtgcta aagaacgtgg atggcaacca gaggaggtta ctgtaaagaa agaagaagta
     1321 gaggagtctc caactcttgt caaacaagaa ctcactcttg ttaaacaaga acccactttt
     1381 gccgagcaac tcgagccaat ggctcaacca ttggtgtag
//