Dbfetch

LOCUS       NM_001306556            1917 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans RFX-like transcription factor daf-19
            (daf-19), partial mRNA.
ACCESSION   NM_001306556
VERSION     NM_001306556.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1917)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1917)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1917)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1917)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003280).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1917
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="II"
     gene            <1..>1917
                     /gene="daf-19"
                     /locus_tag="CELE_F33H1.1"
                     /db_xref="GeneID:174577"
                     /db_xref="WormBase:WBGene00000914"
     CDS             1..1917
                     /gene="daf-19"
                     /locus_tag="CELE_F33H1.1"
                     /standard_name="F33H1.1e"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="RFX-like transcription factor daf-19"
                     /protein_id="NP_001293485.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00000914"
                     /db_xref="EnsemblGenomes-Tr:F33H1.1e"
                     /db_xref="GeneID:174577"
                     /db_xref="GOA:S6EZR7"
                     /db_xref="InterPro:IPR003150"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="InterPro:IPR039779"
                     /db_xref="UniProtKB/TrEMBL:S6EZR7"
                     /db_xref="WormBase:WBGene00000914"
                     /translation="MEVIQHSTDDPNGTREEFDYNQIEYGNAVTPNGTYTLYAPDSNY
                     APYYQYSNNMQSSPQDNAPYLVPAPQSPVSIDDADSINLPNNQRASPATVNWLFENYE
                     IGEGSLPRCELYDHYKKHCAEHRMDPVNAASFGKLIRSVFHNLKTRRLGTRGNSKYHY
                     YGIRLKDSSTLHSMQHPQPQIIQNTYTPPMQLPQRDAYADTVNQVAAIKYMDVEIPDK
                     RARKDNSSSSSSCRDSVSPCMDLPAQQTIQHTPVHSVIPSTQQPAPLHNNNVVSYVVT
                     ESDKAAMGKIDLPIVPFPDKDALMATIGFRKLGVGEEELNSLIDIYEILCREILALIK
                     NIDFASVEDTWSKFWSGNFGVDRDHISALCTLDQVQDYIIEVDLALYQTIVDTLIPNV
                     LLSELSTGMTQTCRTFAKNIDVYLRKSLMLANLGEFFVKKKIQAIKYLQQGLKRYTSL
                     NHLAHASRGVLMKPEQVQQMYQDYIRVDINTVHQQAGWICGCDSVMVHHVNNAFKHNL
                     QRMSAMEVWAEWLESIVDQVLAKYHDKPANVIANVGKQFLLNWSFYTSMIIRDLTLRS
                     AMSFGSFTLIRLLADDYMYYLIESKIAKAGKQQLITVIRADKDWPLTTNPQEYIVVAN
                     DNDEDLDLEKAGLL"
     STS             652..1495
                     /gene="daf-19"
                     /locus_tag="CELE_F33H1.1"
                     /standard_name="F33H1.1"
                     /db_xref="UniSTS:321430"
ORIGIN      
        1 atggaggtca tccaacactc gacagacgat ccgaatggca cgcgagagga attcgactat
       61 aatcaaattg aatatggaaa cgcggttact ccaaatggca catacactct ctatgctccg
      121 gattcaaact atgcgccgta ctatcagtat tcaaacaaca tgcagtcaag ccctcaagac
      181 aatgcaccat atttggtccc tgctccacag tccccggtct cgatcgacga cgcagactcg
      241 atcaacttgc cgaacaatca acgagcttcc cccgcaacgg tgaactggct cttcgagaat
      301 tacgagattg gagaagggtc gctgccaaga tgtgaactct acgatcacta caaaaagcat
      361 tgcgctgaac atcgaatgga tccagtgaac gctgcctcat tcggaaagct catccgatcc
      421 gtcttccaca acctcaagac ccgacggctg ggcacccgcg gcaactcgaa gtaccactac
      481 tatggcatcc gtctgaagga ctcctcaacg cttcattcca tgcagcatcc acagcctcaa
      541 atcattcaaa acacatacac tccgccaatg cagctaccgc aaagagatgc gtatgctgat
      601 acggtaaacc aggtggcagc aatcaaatat atggatgttg agattccgga taaacgagcg
      661 agaaaggaca actcatcgtc gtcatcatcc tgcagagaca gcgtctctcc ttgcatggat
      721 cttccagctc aacaaaccat acagcatacc cccgtccact cagtcatacc atcaacgcaa
      781 caacctgctc cattacataa caacaatgta gtatcgtatg tagtaactga aagtgataaa
      841 gccgcgatgg gaaagattga tcttccaatt gtgccgtttc cggataagga tgcactgatg
      901 gctactattg gattccgaaa acttggcgtc ggagaggaag agctcaactc tttgattgac
      961 atctacgaaa tcttgtgccg agaaattctg gctctgatca aaaacattga ttttgcatca
     1021 gtagaagaca cttggagcaa attttggtcc ggaaactttg gagttgatcg agatcacatt
     1081 agtgctcttt gtacactcga tcaagttcaa gactacatta ttgaagtgga ccttgcattg
     1141 taccaaacca tcgtcgatac tcttatccca aacgttttgc tctcggagct ctccacagga
     1201 atgacccaga cgtgccgaac atttgctaaa aatattgatg tgtacttgag gaaatcgctg
     1261 atgctcgcaa atctcggaga gtttttcgta aaaaagaaga tccaggcaat caagtatttg
     1321 caacaagggc tcaaacgata cacttctttg aatcatttgg ctcacgcttc tcgtggagtt
     1381 ttgatgaaac cagagcaagt tcagcagatg tatcaagact atattcgagt tgatatcaac
     1441 acagtccacc agcaagccgg atggatttgt ggttgcgata gtgtcatggt gcaccatgtg
     1501 aacaacgcct tcaagcataa ccttcaacgg atgagtgcaa tggaggtatg ggccgagtgg
     1561 ctggaaagta ttgtggatca agtgctcgcc aagtatcacg acaaaccggc aaacgtgatt
     1621 gctaatgtcg gaaagcaatt tctgctcaac tggagtttct acacatcgat gatcattcgg
     1681 gatctgactt tgcgatcagc catgtcattc ggatctttca ctctgattag gttgctggcc
     1741 gatgattaca tgtattattt aattgagtcg aaaattgcta aagccggaaa acaacaactc
     1801 atcacggtaa ttcgtgccga caaggactgg ccgttgacta caaaccctca ggaatacata
     1861 gtggtagcca atgacaatga cgaagacctt gacctcgaga aagcaggtct tctgtaa
//