Dbfetch

LOCUS       NM_001270297            2544 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Neuroligin-1 (nlg-1), partial mRNA.
ACCESSION   NM_001270297
VERSION     NM_001270297.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 2544)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 2544)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2544)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 2544)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003284).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..2544
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="X"
     gene            <1..>2544
                     /gene="nlg-1"
                     /locus_tag="CELE_C40C9.5"
                     /db_xref="GeneID:181484"
                     /db_xref="WormBase:WBGene00006412"
     CDS             1..2544
                     /gene="nlg-1"
                     /locus_tag="CELE_C40C9.5"
                     /standard_name="C40C9.5e"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Neuroligin-1"
                     /protein_id="NP_001257226.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006412"
                     /db_xref="EnsemblGenomes-Tr:C40C9.5e"
                     /db_xref="GeneID:181484"
                     /db_xref="GOA:G5EED7"
                     /db_xref="InterPro:IPR002018"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G5EED7"
                     /db_xref="WormBase:WBGene00006412"
                     /translation="MERIYLLLLLFLPRIRSYDVRSVTTSWGMVRGEVVSPEGDDLPP
                     VAQYLGIPYGVAPTGQYRFNMAISAAKWTHMPKDARKVSPVCIQTDMPELSETKRFRA
                     FKHTSAQRFDFNHRLLPHLKKQSEDCLYMNIYVPERLEISRDNYLPVMVIVHGEEYGW
                     GTGNAFNGTTLAAYGHIIVVTLNYRLGVFGFLGRCESSSCSGNSGISDLVSALTMLNV
                     ILPSFGGDSKSVTLAGWGSGASLVSLLMASPLTQPGRRLFRRAILLDGSALSPWAISQ
                     NPQQYFMQLAEELACAPKNRTSSFNDNVDTIVRCMQVHSSENITKAVLKIDVPTFLSG
                     FAPIVDGQLIPNKPQVSFSTQYGSLFREIDLLVGISSNPSHHMISNEDLKVGISKEKR
                     MRIFRSLVRNLYDFHREEILASIINEYTDWENPRDHPKSIRNGVLNALSDVLYTAPLI
                     ETLRSHSADEVRKEANTFMFAFAHETRSWSQEQPNSGIRGSLSGDIVPYIFGYPLAQG
                     DSEERLYSGFNTDDKGISKVMMHYVSNFVKSGDPSKPNPMSKNFPMGDVFHSTAWPQF
                     DQPNREAYLEITDRPRVKNYYRNAQVGFWNNFIPQLHKNGKETEPVGEEHHLLSDHFR
                     KDSYFGKTRHFSSYANLPFPPPPMPPSPPPELTTKPKPSESPTTLQTTTESEKAAAGS
                     FTGKALGGVIFIGCGFLIMNVCLLIAVRREWGKKRRNEKKFQLQYQTYNSNHGGGAEQ
                     YNSLNSPLSLMPPPPPPLNGVHDDIFDHRVPHLRNGSTVHGTLPRHSFQEQAREPLLS
                     ASHKNSTSMRPAGISPTCPRHGRAALALQNSRGNSLTAAQAPTLEEIQV"
     STS             1183..1994
                     /gene="nlg-1"
                     /locus_tag="CELE_C40C9.5"
                     /standard_name="C40C9.5"
                     /db_xref="UniSTS:312518"
ORIGIN      
        1 atggaacgca tttatcttct tctccttctt tttctgccca ggatacgatc ctatgatgtt
       61 cgatcagtca ccacatcctg gggcatggtg agaggtgaag tggttagccc cgaaggagat
      121 gatctaccgc cagtagcaca gtatctaggc attccgtatg gcgtggctcc tactggacag
      181 tatcgtttca acatggccat atctgccgcc aaatggacac atatgccaaa ggacgcgcgc
      241 aaagtttctc cagtctgcat tcaaactgac atgccggaat taagtgaaac aaaacgtttc
      301 agagcattca aacatacttc tgcacagcgt tttgacttta atcatcgact gcttccgcat
      361 ctcaagaaac aatcggaaga ctgtctctac atgaatatct acgttccgga gagattagaa
      421 atctccaggg acaactactt accggtaatg gtaattgtac acggagaaga gtatggatgg
      481 ggtacgggca acgcatttaa tggtaccacg ttggctgctt acggtcatat tattgtagtc
      541 acattgaact atagactggg tgttttcggg tttttgggac gatgtgaatc atcgtcttgc
      601 tctggtaata gtggaatttc ggatctggta tcggctttga caatgctcaa tgttattttg
      661 ccttcatttg gtggagactc taaatcggtc actcttgctg gttggggttc tggcgcttct
      721 ctggtttctc ttcttatggc ttccccatta acacaacctg gcagacgtct attccgacga
      781 gcaattcttc tggacggaag cgctttatcg ccctgggcaa tctctcagaa tcctcaacag
      841 tactttatgc agcttgccga ggaacttgcg tgtgctccaa aaaacagaac atcatctttc
      901 aacgacaatg tggacaccat tgtccgatgt atgcaagtac actcatcgga aaacatcaca
      961 aaagcggttc tcaaaatcga tgttcccacg tttttgtcgg gattcgcgcc gattgttgat
     1021 ggacagctca taccaaataa accgcaagta tcattctcca cccaatacgg atcactcttc
     1081 cgagaaattg atttgctagt aggaatcagc tcgaatccat cccaccacat gatttccaat
     1141 gaggatctga aagtaggcat ctccaaagaa aagcggatga gaatctttcg gtcgttggta
     1201 cgaaatttgt atgatttcca cagggaagaa attcttgcgt caatcatcaa tgagtataca
     1261 gattgggaaa atcccaggga ccacccgaaa tcaattcgaa atggagttct gaatgctctt
     1321 agcgacgtac tttacaccgc acctctcatt gaaacattgc gaagtcacag cgctgatgaa
     1381 gttcgcaaag aggcaaatac gttcatgttt gcatttgccc atgagacccg gtcttggagc
     1441 caagagcaac caaacagtgg aataaggggc tctctatctg gagacattgt accatacatt
     1501 ttcggatacc cattagctca aggggatagt gaggagaggt tgtattcagg atttaacact
     1561 gacgataaag gcatttcaaa agttatgatg cattatgtat caaactttgt aaaatcggga
     1621 gatccatcaa agccaaatcc aatgtccaaa aacttcccaa tgggggacgt gtttcattca
     1681 acagcctggc cacaatttga ccaaccaaat agagaagctt atttggaaat tactgatcgc
     1741 cctcgagtca aaaactacta tcggaatgct caagtaggat tttggaataa ctttatcccg
     1801 caattgcaca agaatggaaa ggaaacagag cctgttggag aagagcatca tttgctgtca
     1861 gatcatttcc gaaaagactc ttactttgga aaaacccgtc atttttcttc atatgcgaat
     1921 cttccgttcc cgccaccacc aatgccccca tcaccaccac cagagcttac aacaaagccc
     1981 aaaccaagtg aatcgcccac aactctccaa acaacaactg aaagtgaaaa ggccgccgct
     2041 ggaagtttta ctggaaaagc tctcggtggc gttattttca tcggttgtgg attcctcatt
     2101 atgaacgttt gcctattaat tgctgttcgt agagaatggg gaaagaagcg gcggaacgag
     2161 aagaagtttc aactgcagta tcagacttat aactccaacc atggcggcgg cgcggaacaa
     2221 tacaacagct taaactcgcc gttatccctc atgccaccac ctccgccacc gctcaatggt
     2281 gttcacgacg acattttcga tcatcgggtg ccgcatcttc ggaacggatc cacggttcac
     2341 ggcacgcttc cgaggcattc atttcaggaa caggcacgtg aacccttact atccgcatcg
     2401 cacaagaact caacttcgat gcgacccgcg ggaatatcac caacgtgtcc acgtcacgga
     2461 cgtgccgcgc ttgcgcttca aaatagccga ggtaacagtt tgactgctgc tcaagcaccg
     2521 acattggaag agatacaggt ctaa
//