Dbfetch

LOCUS       NM_001270296            2292 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Neuroligin-1 (nlg-1), partial mRNA.
ACCESSION   NM_001270296
VERSION     NM_001270296.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 2292)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 2292)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2292)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 2292)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003284).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..2292
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="X"
     gene            <1..>2292
                     /gene="nlg-1"
                     /locus_tag="CELE_C40C9.5"
                     /db_xref="GeneID:181484"
                     /db_xref="WormBase:WBGene00006412"
     CDS             1..2292
                     /gene="nlg-1"
                     /locus_tag="CELE_C40C9.5"
                     /standard_name="C40C9.5d"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Neuroligin-1"
                     /protein_id="NP_001257225.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006412"
                     /db_xref="EnsemblGenomes-Tr:C40C9.5d"
                     /db_xref="GeneID:181484"
                     /db_xref="GOA:G5ECG6"
                     /db_xref="InterPro:IPR002018"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G5ECG6"
                     /db_xref="WormBase:WBGene00006412"
                     /translation="MERIYLLLLLFLPRIRSYDVRSVTTSWGMVRGEVVSPEGDDLPP
                     VAQYLGIPYGVAPTGQYRFNMAISAAKWTHMPKDARKVSPVCIQTDMPELSETKAFKH
                     TSAQRFDFNHRLLPHLKKQSEDCLYMNIYVPERLEISRDNYLPVMVIVHGEEYGWGTG
                     NAFNGTTLAAYGHIIVVTLNYRLGVFGFLGRCESSSCSGNSGISDLVSALTMLNVILP
                     SFGGDSKSVTLAGWGSGASLVSLLMASPLTQPGRRLFRRAILLDGSALSPWAISQNPQ
                     QYFMQLAEELACAPKNRTSSFNDNVDTIVRCMQVHSSENITKAVLKIDVPTFLSGFAP
                     IVDGQLIPNKPQVSFSTQYGSLFREIDLLVGISSNPSHHMISNEDLKVGISKEKRMRI
                     FRSLVRNLYDFHREEILASIINEYTDWENPRDHPKSIRNGVLNALSDVLYTAPLIETL
                     RSHSADEVRKEANTFMFAFAHETRSWSQEQPNSGIRGSLSGDIVPYIFGYPLAQGDSE
                     ERLYSGFNTDDKGISKVMMHYVSNFVKSGDPSKPNPMSKNFPMGDVFHSTAWPQFDQP
                     NREAYLEITDRPRVKNYYRNAQVGFWNNFIPQLHKNGKETEPVGEEHHLLSDHFRKDS
                     YFGKTRHFSSYANLPFPPPPMPPSPPPELTTKPKPSESPTTLQTTTESEKAAAGSFTG
                     KALGGVIFIGCGFLIMNVCLLIAVRREEPLLSASHKNSTSMRPAGISPTCPRHGRAAL
                     ALQNSRGNSLTAAQAPTLEEIQV"
     STS             1174..1985
                     /gene="nlg-1"
                     /locus_tag="CELE_C40C9.5"
                     /standard_name="C40C9.5"
                     /db_xref="UniSTS:312518"
ORIGIN      
        1 atggaacgca tttatcttct tctccttctt tttctgccca ggatacgatc ctatgatgtt
       61 cgatcagtca ccacatcctg gggcatggtg agaggtgaag tggttagccc cgaaggagat
      121 gatctaccgc cagtagcaca gtatctaggc attccgtatg gcgtggctcc tactggacag
      181 tatcgtttca acatggccat atctgccgcc aaatggacac atatgccaaa ggacgcgcgc
      241 aaagtttctc cagtctgcat tcaaactgac atgccggaat taagtgaaac aaaagcattc
      301 aaacatactt ctgcacagcg ttttgacttt aatcatcgac tgcttccgca tctcaagaaa
      361 caatcggaag actgtctcta catgaatatc tacgttccgg agagattaga aatctccagg
      421 gacaactact taccggtaat ggtaattgta cacggagaag agtatggatg gggtacgggc
      481 aacgcattta atggtaccac gttggctgct tacggtcata ttattgtagt cacattgaac
      541 tatagactgg gtgttttcgg gtttttggga cgatgtgaat catcgtcttg ctctggtaat
      601 agtggaattt cggatctggt atcggctttg acaatgctca atgttatttt gccttcattt
      661 ggtggagact ctaaatcggt cactcttgct ggttggggtt ctggcgcttc tctggtttct
      721 cttcttatgg cttccccatt aacacaacct ggcagacgtc tattccgacg agcaattctt
      781 ctggacggaa gcgctttatc gccctgggca atctctcaga atcctcaaca gtactttatg
      841 cagcttgccg aggaacttgc gtgtgctcca aaaaacagaa catcatcttt caacgacaat
      901 gtggacacca ttgtccgatg tatgcaagta cactcatcgg aaaacatcac aaaagcggtt
      961 ctcaaaatcg atgttcccac gtttttgtcg ggattcgcgc cgattgttga tggacagctc
     1021 ataccaaata aaccgcaagt atcattctcc acccaatacg gatcactctt ccgagaaatt
     1081 gatttgctag taggaatcag ctcgaatcca tcccaccaca tgatttccaa tgaggatctg
     1141 aaagtaggca tctccaaaga aaagcggatg agaatctttc ggtcgttggt acgaaatttg
     1201 tatgatttcc acagggaaga aattcttgcg tcaatcatca atgagtatac agattgggaa
     1261 aatcccaggg accacccgaa atcaattcga aatggagttc tgaatgctct tagcgacgta
     1321 ctttacaccg cacctctcat tgaaacattg cgaagtcaca gcgctgatga agttcgcaaa
     1381 gaggcaaata cgttcatgtt tgcatttgcc catgagaccc ggtcttggag ccaagagcaa
     1441 ccaaacagtg gaataagggg ctctctatct ggagacattg taccatacat tttcggatac
     1501 ccattagctc aaggggatag tgaggagagg ttgtattcag gatttaacac tgacgataaa
     1561 ggcatttcaa aagttatgat gcattatgta tcaaactttg taaaatcggg agatccatca
     1621 aagccaaatc caatgtccaa aaacttccca atgggggacg tgtttcattc aacagcctgg
     1681 ccacaatttg accaaccaaa tagagaagct tatttggaaa ttactgatcg ccctcgagtc
     1741 aaaaactact atcggaatgc tcaagtagga ttttggaata actttatccc gcaattgcac
     1801 aagaatggaa aggaaacaga gcctgttgga gaagagcatc atttgctgtc agatcatttc
     1861 cgaaaagact cttactttgg aaaaacccgt catttttctt catatgcgaa tcttccgttc
     1921 ccgccaccac caatgccccc atcaccacca ccagagctta caacaaagcc caaaccaagt
     1981 gaatcgccca caactctcca aacaacaact gaaagtgaaa aggccgccgc tggaagtttt
     2041 actggaaaag ctctcggtgg cgttattttc atcggttgtg gattcctcat tatgaacgtt
     2101 tgcctattaa ttgctgttcg tagagaagaa cccttactat ccgcatcgca caagaactca
     2161 acttcgatgc gacccgcggg aatatcacca acgtgtccac gtcacggacg tgccgcgctt
     2221 gcgcttcaaa atagccgagg taacagtttg actgctgctc aagcaccgac attggaagag
     2281 atacaggtct aa
//