Dbfetch

LOCUS       NM_001270094             963 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Stomatin-2 (sto-2), partial mRNA.
ACCESSION   NM_001270094
VERSION     NM_001270094.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 963)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 963)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 963)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 963)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003284).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..963
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="X"
     gene            <1..>963
                     /gene="sto-2"
                     /locus_tag="CELE_F32A6.5"
                     /db_xref="GeneID:180802"
                     /db_xref="WormBase:WBGene00006064"
     CDS             1..963
                     /gene="sto-2"
                     /locus_tag="CELE_F32A6.5"
                     /standard_name="F32A6.5a"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Stomatin-2"
                     /protein_id="NP_001257023.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006064"
                     /db_xref="GeneID:180802"
                     /db_xref="WormBase:WBGene00006064"
                     /translation="MESDDEGNIQIPVPTGQPRGRMGRRFTLNPLIFAKEEREARRQS
                     LAQLKLSYYPKHMNPEHYDTGLGFCGWFLMGLSWIMVISTFPVSIYFCMKVVQEYERA
                     VIFRLGRLIGGGAKGPGIFFVLPCIESYTKVDLRTVSFSVPPQEILTKDSVTTSVDAV
                     IYYRISNATVSVANVENAHHSTRLLAQTTLRNMLGTRSLSEILSDRETLAASMQTILD
                     EATESWGIKVERVEIKDVRLPIQLQRAMAAEAEATREARAKVIAAEGEQKASRALRDA
                     ASVIAQSPAALQLRYLQTLNSVAAEKNSTIIFPLPMELVRHLIN"
     STS             190..898
                     /gene="sto-2"
                     /locus_tag="CELE_F32A6.5"
                     /standard_name="F32A6.5"
                     /db_xref="UniSTS:314182"
ORIGIN      
        1 atggaatcgg acgatgaagg gaacattcag attccggtgc ccaccggaca acctcgtgga
       61 cgcatgggtc gcaggttcac tctcaaccca ctcatttttg caaaagaaga acgagaagca
      121 cgacggcaat cgttagctca acttaagctc agctattatc caaaacacat gaatcctgaa
      181 cattatgaca ctggtcttgg gttttgtggg tggtttctta tgggactgtc atggataatg
      241 gttatttcta cattcccagt ttcaatttac ttttgtatga aagtggtgca agaatacgag
      301 agagccgtca ttttccgact tggtcgactg attggtggtg gagccaaagg accaggaatt
      361 ttctttgtac ttccgtgcat agaatcgtac accaaggttg atctgagaac agtatcgttt
      421 agtgtgccgc cgcaggaaat tttaacaaaa gattcagtga caacgtctgt cgacgctgtt
      481 atttactata ggatcagcaa tgcaacagtt agcgtggcaa atgttgaaaa tgcacaccat
      541 tctacaagat tgcttgcgca aacaacgctt cgtaatatgt taggtacgag aagcctgtca
      601 gaaattctct cggatcgtga aacacttgca gcatccatgc agacaattct tgatgaagca
      661 actgaaagct ggggaatcaa agtggaaaga gtagaaatca aagatgttcg tctcccaatt
      721 caacttcaac gagcaatggc ggcagaagca gaggccactc gagaagctag agctaaggtg
      781 attgctgcgg aaggagagca gaaagcttct cgggcattgc gtgatgctgc atcagtcatt
      841 gctcagtctc cagctgctct tcaactccga tatcttcaaa ctctgaatag cgtcgcagca
      901 gagaaaaatt cgacgatcat cttcccactt ccgatggaat tagttaggca tctaatcaac
      961 tga
//