Dbfetch

LOCUS       NM_001269738            2220 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Dipeptidyl peptidase family member 1
            (dpf-1), partial mRNA.
ACCESSION   NM_001269738
VERSION     NM_001269738.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 2220)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 2220)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2220)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 2220)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..2220
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            <1..>2220
                     /gene="dpf-1"
                     /locus_tag="CELE_T23F1.7"
                     /db_xref="GeneID:180042"
                     /db_xref="WormBase:WBGene00001054"
     CDS             1..2220
                     /gene="dpf-1"
                     /locus_tag="CELE_T23F1.7"
                     /standard_name="T23F1.7c"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Dipeptidyl peptidase family member 1"
                     /protein_id="NP_001256667.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00001054"
                     /db_xref="EnsemblGenomes-Tr:T23F1.7a"
                     /db_xref="EnsemblGenomes-Tr:T23F1.7c"
                     /db_xref="GeneID:180042"
                     /db_xref="GOA:D6R8X0"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002469"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR038554"
                     /db_xref="UniProtKB/TrEMBL:D6R8X0"
                     /db_xref="WormBase:WBGene00001054"
                     /translation="MIFAALVFFTPLFAAKSFGSWRLNVSDLRSLRYPYAEFAFTDNN
                     AVVMQSWEGVEIVEDGVSRLIFGRENGAEITPSADRKYFAMMDHAPNPGMNPQNETFH
                     LKIVNNNERITYDIGLRKEESVIQAFKWNGKFNDFVFVESNKIYYQSSPEEEGLTRVS
                     NGGEHTVDGLFDWIYEEEIFGRKDAMWWSTKGDQLAYASYDNHLTKNVSLKTYHRLEP
                     YPIDTNFHYPKTFAKVLPTYTLSIWNKKTEQSRQLDVQLKDSLSYHYLLAVKWLEING
                     TEQLVSVWTNRYQNEVALTICDWDTAICRLEFEYKYASKRWVTHDDFHSITSFEDTLF
                     FLLPHDKRDNAFQQVASLRLSHGQLRTPKFLNLGEYDVTSINGINKETRTIFFHAAAP
                     KPSHRSLFSYSLADESRNSAYCISCSIKNCTWAQAQMDDQMKTAIVSCKGPAAPHTAI
                     VNLTRMDSDKKTEHANLLYDKTYQNRVEEAGLPVIIKETIKISDDFDALIKLSIPKDI
                     YNRDKHQAIPLIVHVYGGPNDQNTKEATQIGIEEVVASASQAAILRIDGRGSGGRGWK
                     YRSAIYGQLGTVEVEDQIKAIKVVLRLYRHLLDARRVAVFGWSYGGFMTLSMVNEAPE
                     QFFKCAVSVAPVTNFAYYDATYTERYMGDAPLESYSDVTKKLDNFKSTRLLLMHGLLD
                     DNVHFQNSAILIDELQNRGVDFDLMVYPNQAHSLSSRTSHVVGKMTHFLRQCFYTDK"
     STS             1310..2074
                     /gene="dpf-1"
                     /locus_tag="CELE_T23F1.7"
                     /standard_name="T23F1.7"
                     /db_xref="UniSTS:308088"
ORIGIN      
        1 atgatattcg cagcgctggt attcttcaca ccactttttg ctgctaaatc atttggatcg
       61 tggcggttga acgtttctga tctacgatcg ctacgatatc catatgccga attcgcgttt
      121 accgataaca atgctgttgt tatgcaaagt tgggaaggtg tggaaattgt cgaagatgga
      181 gtatccagac tgatttttgg aagagaaaat ggggccgaga tcacgccgtc cgcagatcgg
      241 aagtattttg ctatgatgga tcacgcgccg aatccgggaa tgaatccgca gaacgagacg
      301 tttcatttga aaattgtgaa caataatgag agaatcacat acgacattgg cctccgcaag
      361 gaagagtccg tgattcaggc gttcaagtgg aatgggaagt tcaatgattt tgttttcgtt
      421 gaaagtaata aaatctacta ccaaagtagt cctgaagaag aaggcttgac tcgtgtgagc
      481 aatggaggtg aacacacagt cgacggactt tttgattgga tctacgagga ggaaatattc
      541 ggaagaaagg atgcaatgtg gtggtcaaca aaaggagatc aactcgcata tgcttcatat
      601 gacaaccatc ttacaaagaa tgtctccttg aaaacctacc accgtctaga gccctaccca
      661 attgacacaa atttccacta cccgaaaacc tttgcaaaag tcttgccaac ttatacgctt
      721 tcgatatgga acaagaaaac ggaacaatcc aggcagttag atgttcagtt gaaggatagt
      781 ctgtcctatc attatttgct ggcagtgaag tggttggaga ttaatggaac agagcaattg
      841 gtgtcggtat ggacaaatcg gtaccaaaat gaggtggcgt tgacgatttg tgactgggac
      901 actgcgattt gtcgtttgga atttgaatac aaatatgcct caaaacgatg ggtaactcat
      961 gatgatttcc actcgatcac ctcattcgag gacactctct tcttccttct tccacatgac
     1021 aaacgtgaca atgccttcca acaagttgca tctcttcgac tctcacatgg acaacttaga
     1081 actccgaagt tcctgaacct cggtgaatac gatgtcacat caatcaacgg tatcaataaa
     1141 gaaaccagaa caattttttt ccacgcagcc gcgccaaaac cttcccacag atcgcttttc
     1201 tcgtatagct tggccgatga atctcgaaac tcggcatatt gcatctcgtg ctctattaaa
     1261 aattgcacat gggctcaagc tcaaatggat gatcagatga aaacggcaat tgtttcatgc
     1321 aaaggaccag ctgcgcccca tacagcaata gtgaacttga ctcgaatgga cagtgacaaa
     1381 aaaacagagc atgcgaatct cctctacgac aaaacctatc aaaatcgtgt agaagaagct
     1441 ggtcttccgg tgattatcaa agagactatc aaaatttctg atgactttga tgcccttatc
     1501 aagctctcaa ttccaaaaga catttacaac cgagacaaac atcaggcaat accgttgatt
     1561 gttcatgtat acggaggacc taacgatcag aacacgaagg aggcgactca aattggaatc
     1621 gaagaagttg tggcttcagc gtcacaagcc gccattttaa ggattgatgg aagaggaagt
     1681 ggtggacgag gatggaagta tagatcagca atttatgggc agttgggaac ggtggaggtg
     1741 gaggatcaga ttaaagctat caaagttgtc ctccgtctct accgtcactt attagatgct
     1801 cgccgagttg ccgtttttgg ctggtcctat ggcggtttta tgacgctctc catggtcaat
     1861 gaagctccag agcagttctt caagtgcgca gtttcagtgg cgccagtcac taattttgca
     1921 tattatgatg caacctacac tgaaagatat atgggtgatg caccgttaga gtcgtacagc
     1981 gatgtgacta agaaattgga caacttcaaa tctacacgac ttcttctgat gcatgggctt
     2041 ctggatgaca atgtgcactt ccaaaacagt gcaatcctaa ttgatgagct acaaaatcgg
     2101 ggagtcgatt ttgacttgat ggtctaccca aatcaagcgc attccctgtc cagtcggacg
     2161 tctcatgtcg ttggaaaaat gacacatttc cttagacaat gtttttacac tgataagtag
//