Dbfetch

LOCUS       NM_001269683            4677 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans SET (trithorax/polycomb) domain containing
            (set-5), partial mRNA.
ACCESSION   NM_001269683
VERSION     NM_001269683.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 4677)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 4677)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 4677)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 4677)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..4677
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            <1..>4677
                     /gene="set-5"
                     /locus_tag="CELE_C47E8.8"
                     /db_xref="GeneID:179973"
                     /db_xref="WormBase:WBGene00008145"
     CDS             1..4677
                     /gene="set-5"
                     /locus_tag="CELE_C47E8.8"
                     /standard_name="C47E8.8a"
                     /note="Product from WormBase gene class set;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="SET (trithorax/polycomb) domain containing"
                     /protein_id="NP_001256612.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00008145"
                     /db_xref="EnsemblGenomes-Tr:C47E8.8a"
                     /db_xref="GeneID:179973"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR006570"
                     /db_xref="UniProtKB/TrEMBL:G5EEE4"
                     /db_xref="WormBase:WBGene00008145"
                     /translation="MNPKNKSSTIISKNVEELLPTLFPITEVRSFGKKCRSIEISKSY
                     LINRALVSNLDIEPDEPIVRIRGLLAFHHELQEDSRNVNFLFTYGCVCLDARGTGNNP
                     GRFVRRSCFPNSYLSYERNNTEFHIIIKARDFIPYGHEITIDFNDDFFPLNCSLKCTV
                     HLEDSENCRREWKRKYIQNDGYWKPPELSISASSSSTSQIDPEPSKTPFNEEQEKLLK
                     SIINQSKIIPMMPRHTKHLCHVFKQEFGSEKTVEEIDDDLGKLISDFTSRVMKSNIVL
                     NDDRLMNAITLRNVLYVTSVSVEENVLEWLHDAGVNVFLNKNRQLFLMKYSKTDKSPL
                     NVHSLDRKTKDYELYLKEQMTKLLAGMPDESGRETSQAANEVEVQAAMENVEEGEIVP
                     ESGNRVFSPLPPPPPPPLEMSRESSPISSVSGKSIKLLTLQLKETMHKKNSFFHSSYV
                     KKEETGIINGESIQVTKKAESSQFSDSSPILLVNPHVHTEAPEPTPKEHMERKWSTTH
                     SGSMGELQRPVTSQSSRKSSRWDVTEEDLKRKLSATSSTHNPRERASVELETRQSEEI
                     QKLQRLVNVIKPRDDSLEGTSNLDAANREIPIEASSTAPLLSRSFQFWRERSKSPDDS
                     AQNHSDLHGTSLKSRPDAQKNPIPQAVAKTMLKFPVSTLDRPVNTKKSMAFGQEAQIM
                     PKSSVFVNNAVKIPQKFVIVKEASSDNPNAAENPVSTQNTVDLHDIPSKTPQQKVTSE
                     NRGSGAPNSSEDQQKLDEIAPTTQILPEDPVSVQSRSDVCEVTAETSQKSVGPERIGG
                     DAQSSSENTVSVRNRVDLHGIPSKTPQKLVQSGKSAQSSTENQQQIEMTPEARILSKN
                     PISAQSKTPVKEERPESHSLSESFASTQHPMKISEISENSTQNRSDSSRIGLRSVKLE
                     QIPSRTIKVEEPTDFPSNSEPEAQIPLETRTLEPSEASSVQPEPPIDQEEAENDENPE
                     ILTPNSPTIDQDEAQNSDAPDASADSDLPKLEPELERMIDFLVEITEKISVPAIKTDI
                     WKLYQARMKQNVKEECIRQRFMSKLAPIIHRLDNYSIEARVRIIFVLSVKVDADFLKE
                     LRKNAVVRVDDEQLITKYVSCNDGGLKLEGNHSMSDRLKNRKRSLDLIKDVDCEKKEA
                     EHDVKKTKKSTSGSENDTDAEETDFHSITERQPKVVENSENRKRASSAKRRLVTSSSE
                     ESDQDDRSSRSKTEKQRKIAANEKRSSTASRVRILSDSSDESNREEGPSCSNSKKLTK
                     ISGNKKNPAILRKRLLGDSSDKSDKDERTSCPSSKKRPKLAENKKNASQPKRCLSGSN
                     VKSDKNEKAGCSGTKKQEKVVKNKKKPPTPKANENTTTSDHSRIETDDIQFEGVYPIE
                     PCAPVSSGMPILSVKTEPRSTEHLSFSYENVAYTQAEFSSTTYACPEPTETISLHDFL
                     TLLRRLLILLQCEELAELARNIKTISETGGDEKIPTNRINSVLDVAFYKIQRKFVVTS
                     SPNSTSAREFLKLFKNLLNLLESRAVDMLLGQVSGKLSELEHVDMNLSIAYIEECVRA
                     ILSIFS"
     STS             1679..2748
                     /gene="set-5"
                     /locus_tag="CELE_C47E8.8"
                     /standard_name="C47E8.8"
                     /db_xref="UniSTS:309323"
ORIGIN      
        1 atgaacccga aaaacaaatc atcaacaatc atttcgaaaa acgtcgagga gctgcttccg
       61 acactattcc ccatcacaga agttcgaagt ttcggaaaaa agtgtcgcag tatcgaaatt
      121 tcgaaatcct atttaatcaa cagagctctc gtctcaaatc tagacatcga gccggacgag
      181 ccaattgtga ggattcgagg attattggca tttcatcatg aacttcaaga agattctcga
      241 aatgtgaact ttctattcac atacggatgt gtctgtttgg atgctcgagg gactggaaat
      301 aatcctggaa gatttgtccg aagaagctgc tttccgaata gttatcttag ttatgaaaga
      361 aacaatacag aattccatat aattatcaaa gcaagagact tcattccata tggacatgag
      421 attactatcg attttaatga cgatttcttt cctttgaatt gttcattaaa atgtactgtg
      481 cacttggagg attctgagaa ttgtcgacgg gaatggaaga gaaagtatat tcagaatgat
      541 ggttattgga aaccgccgga actctctatt tccgcatctt caagcagcac ttcacaaatc
      601 gatcctgaac catcaaaaac accatttaac gaagaacaag agaaactact taaatcgatt
      661 atcaatcaat caaaaatcat tccgatgatg ccacgacaca cgaaacatct gtgccacgtg
      721 ttcaagcagg agtttggatc agagaagact gtcgaggaga ttgacgatga tctaggaaaa
      781 ttaatttcgg atttcactag tcgagtgatg aaatcgaata ttgtattgaa tgatgatcgt
      841 ctgatgaatg caataacatt acgcaatgtt ttgtatgtga caagtgtatc agttgaagag
      901 aatgtactag aatggctcca cgacgctggt gtcaatgtgt ttctgaacaa gaatcgacag
      961 ttatttttga tgaaatattc gaagacagac aagagtccgt tgaatgtaca cagtttggat
     1021 cgaaaaacca aagactatga gctgtatttg aaggaacaga tgacgaaact tcttgcaggg
     1081 atgcctgatg aatctggaag agaaaccagc caagcagcaa atgaagtaga agttcaggca
     1141 gcgatggaga acgtggaaga aggagaaatt gtcccagaga gcggaaatcg cgtgttctca
     1201 ccattgccac caccgccacc tccacctctg gaaatgtcaa gagaatcatc gccgattagc
     1261 tcagtttcag gaaaatccat taaacttctc acacttcaac taaaggaaac tatgcataag
     1321 aagaattctt tttttcattc cagttatgtt aagaaggaag aaacgggaat tatcaatgga
     1381 gagtcgatac aagttacgaa aaaagctgaa tcatctcaat tttcggattc ctctccaatt
     1441 cttctagtaa atccacacgt tcacacagaa gcgccggaac caactccaaa agagcatatg
     1501 gagagaaaat ggagcaccac ccattctgga agcatgggtg agctccagag acctgtgacg
     1561 tcacaaagtt ccagaaaatc gagtcgctgg gatgtcactg aagaggattt gaaacgaaaa
     1621 ctttccgcca cgtcatccac ccacaatccg agagaacgtg cttccgtgga actggaaacc
     1681 cgacaatccg aagagataca aaaacttcag cgacttgtga acgtgataaa gcctcgtgat
     1741 gattctctgg agggcacctc gaatttggat gctgcaaatc gagaaattcc aattgaagca
     1801 tcgagcacag cgccgctcct ttcgagaagt tttcaatttt ggcgggaacg ctcaaaatct
     1861 cctgatgatt ctgctcaaaa tcactcggat ttgcacggaa cttcattgaa aagccgtcca
     1921 gatgctcaga aaaatccaat tccgcaagca gtagctaaaa cgatgttgaa atttccagtt
     1981 tctactctag accggccggt taatacaaaa aaatcgatgg catttggaca agaagctcaa
     2041 atcatgccga aaagttcagt tttcgttaat aatgcggtga aaatcccaca aaaatttgtc
     2101 atagtgaagg aagctagctc tgataatcca aatgcggcgg aaaatccagt ttctactcaa
     2161 aataccgtgg atttgcacga tattccatcg aaaaccccgc aacagaaggt tacgtcggag
     2221 aatagaggct caggtgctcc aaattcgtca gaagatcagc aaaagctcga cgaaatagcg
     2281 ccaacaactc aaattttacc ggaagatcca gtttctgttc aaagtcgctc ggatgtgtgc
     2341 gaagttacag cagaaacttc tcaaaaatcg gttggaccgg agagaattgg cggagatgct
     2401 caaagttcat cggaaaatac agtttctgtt cgaaatcgcg tggatttgca cggaatccct
     2461 tcgaaaactc cacaaaaatt ggttcagtca ggaaaaagtg ctcaaagttc gacggaaaat
     2521 caacaacaga ttgaaatgac accagaagct cgaattttat caaaaaatcc aatttcggct
     2581 caatcgaaaa ccccggtgaa agaagaacgt cccgaatctc acagtttgtc ggaaagtttc
     2641 gcttcaaccc agcatccaat gaaaatctcg gaaatatctg aaaattccac ccaaaatcgt
     2701 tcggattcgt cgagaattgg gctgcgatcg gtgaaattgg agcaaattcc gtcgagaacc
     2761 atcaaagtag aagaaccaac ggatttccca tcaaactcgg agccagaagc tcaaattccg
     2821 cttgaaacga gaactttgga gccgtccgaa gcttcaagtg tgcaaccgga gcccccaatc
     2881 gaccaggaag aagctgaaaa tgatgagaat ccagaaattt tgactccaaa ctcgccaaca
     2941 attgatcagg atgaagctca aaattcagat gcaccagatg cttccgcgga ttcagatttg
     3001 ccgaaattgg agccagaact cgagcgaatg attgattttc tcgtggaaat tacagagaaa
     3061 atcagtgttc cagcgattaa aacagatatt tggaaattgt atcaagcaag gatgaagcag
     3121 aatgtaaaag aggaatgtat tcgtcaaaga ttcatgtcaa aactggctcc gattatacat
     3181 cgtttggata attatagcat tgaggctcga gttcgcatca ttttcgtttt gagtgttaag
     3241 gtggatgcgg attttttgaa agagcttcgc aaaaacgccg tggttcgtgt tgatgacgag
     3301 caattgatta caaagtatgt gtcttgtaat gatggtggat tgaagcttga aggaaatcat
     3361 tcaatgtcgg ataggttaaa gaatcgaaag agaagtttgg atttgattaa ggatgtcgat
     3421 tgtgagaaga aagaggccga gcatgatgtt aaaaagacga aaaagagcac tagtggttct
     3481 gagaatgaca ccgacgcaga ggaaacggat tttcattcga taactgaacg acaaccgaaa
     3541 gttgttgaaa attctgaaaa taggaagaga gcttcgtcag ccaaaagacg tctagtgaca
     3601 agttcttctg aagaaagtga ccaggatgat cgatcgagtc gatcaaaaac tgaaaagcaa
     3661 cggaaaattg cagcaaatga gaaaagatct tccaccgcat ccagagtgcg tatattgagt
     3721 gactcatcag acgaaagtaa cagagaggaa ggaccaagtt gctcgaattc caaaaagctg
     3781 actaaaattt caggaaataa gaaaaacccc gcgatactcc gaaaacgttt gctgggagac
     3841 tcttccgaca aaagtgacaa ggacgagaga acaagctgcc caagttccaa aaaacgacca
     3901 aaacttgctg aaaataagaa aaacgcttcc caacccaaaa gatgtctcag tggctctaat
     3961 gtgaaaagcg acaaaaatga gaaagctggt tgttcgggca ccaaaaaaca agaaaaagtc
     4021 gtcaaaaata agaaaaaacc tccaactcca aaggccaatg aaaataccac tacttctgat
     4081 cattccagaa ttgaaactga tgatattcaa tttgaaggag tatatccaat tgaaccctgt
     4141 gctcctgtat cttctggaat gccgattctt tctgtgaaaa ctgagccaag aagcactgaa
     4201 catttgagct tctcctatga gaacgtggca tacacccaag cggaattctc ttcgacgacc
     4261 tacgcatgtc cagaaccaac agagacaatc agccttcacg attttttgac acttttacgt
     4321 cgccttctta ttctgttgca atgcgaagag ctcgcggagc tcgcaagaaa tatcaagaca
     4381 attagcgaaa ctggaggcga tgaaaaaatt ccaacgaatc gaatcaattc ggtgctcgac
     4441 gtggcattct acaaaattca gcgaaaattc gtcgtgacgt catctcccaa ttcgacgagc
     4501 gcccgagaat tcctgaaact tttcaagaat ctcctaaatt tgttggaatc tcgagcagtc
     4561 gacatgctct tgggccaagt ttcagggaaa ttgtcggagt tggagcatgt ggatatgaat
     4621 ctttcaattg cctatatcga agaatgtgtc agggcaattc tctccatctt ctcataa
//