Dbfetch

LOCUS       NM_001269635             690 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Serine/threonine-protein kinase par-1
            (par-1), partial mRNA.
ACCESSION   NM_001269635
VERSION     NM_001269635.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 690)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 690)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 690)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 690)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..690
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            <1..>690
                     /gene="par-1"
                     /locus_tag="CELE_H39E23.1"
                     /db_xref="GeneID:179912"
                     /db_xref="WormBase:WBGene00003916"
     CDS             1..690
                     /gene="par-1"
                     /locus_tag="CELE_H39E23.1"
                     /standard_name="H39E23.1i"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Serine/threonine-protein kinase par-1"
                     /protein_id="NP_001256564.1"
                     /db_xref="GeneID:179912"
                     /db_xref="WormBase:WBGene00003916"
                     /translation="MSMTQSPSQLSSRFTSNYVAPIVRSKPPAPVSTPAAPSATAPIP
                     VIVSPAVTKMLKENRRKLSEEAMAIRRDHNRESMTQPVSGRAGTIGASQGQQTAAALA
                     AIREQSGPIAPGAGQVAPSLPIHEGDVKPRSLRFTWSMKTTSSLAPDDMMREIRKVLD
                     ANGCDYEQRERYMILCVHGDPNTDSLVQWEMEVCKLPRLSLNGVRFKRISGTSIGFKN
                     IASKIAQELNL"
ORIGIN      
        1 atgtcgatga cacaaagccc atcccaactg tcgtctcgtt ttacttccaa ctatgttgct
       61 ccgattgttc gttcaaagcc accagctcca gtttcaactc ccgcagctcc ttcagcaacg
      121 gctccgattc cagttattgt gtctccagcc gtcacgaaaa tgctgaaaga gaatagaaga
      181 aagttgtcag aagaggcaat ggctattcga agagatcata atcgagaaag tatgacccag
      241 ccagtatcag gacgtgctgg aaccatcgga gcatcacaag gacagcaaac cgcggcggct
      301 cttgctgcga ttcgggaaca gtctggccca attgctccag gtgccggaca agttgcacca
      361 tcgcttccga ttcatgaagg agacgtcaag ccacgatcat tgcggttcac gtggagtatg
      421 aagacgactt cttcattggc tccggatgat atgatgagag aaattcgaaa agttcttgac
      481 gctaacggtt gtgactacga gcaacgggaa cgatacatga ttctgtgtgt gcacggtgat
      541 ccgaatacag actcacttgt tcaatgggag atggaggtct gcaagttgcc acgtctcagt
      601 ctgaatggag ttcgattcaa acgaatctcg ggaacatcga ttggcttcaa gaatatcgct
      661 tcgaaaatag cccaagagct gaacctttag
//