Dbfetch

LOCUS       NM_001269634            1785 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Serine/threonine-protein kinase par-1
            (par-1), partial mRNA.
ACCESSION   NM_001269634
VERSION     NM_001269634.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1785)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1785)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1785)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1785)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1785
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            <1..>1785
                     /gene="par-1"
                     /locus_tag="CELE_H39E23.1"
                     /db_xref="GeneID:179912"
                     /db_xref="WormBase:WBGene00003916"
     CDS             1..1785
                     /gene="par-1"
                     /locus_tag="CELE_H39E23.1"
                     /standard_name="H39E23.1k"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Serine/threonine-protein kinase par-1"
                     /protein_id="NP_001256563.1"
                     /db_xref="GeneID:179912"
                     /db_xref="WormBase:WBGene00003916"
                     /translation="MSGTRHGGVQMRAQPTSRQATISLLQPPSYKPSSNTTQIAQIPP
                     LFNRNSTATSSAAQPSTGITGTRKIADPKGRIPLNSTAVQGHRTATGAVAANNGGIPS
                     HRDHAQQQQYMNQLTSSTMMSKLINKTPAAGGTAATSSSSSSSATSTAPLQKSGSQIS
                     HAPTEPVIREDDDENNSENQNGNVPLIGGVGPQTSPAVQVPTEDATSSSDKEQQQQKA
                     SSETPKESKPSMIHQSPSMPPSQMMTAMESLKLSESGQTGGPTVATGGPPQRATSQQM
                     SRSATTNSANMGASSGGAAAAASATNQLSGAPSSTGASSQQYHPKAPSSSSSSSTNPP
                     HQHQLTHNASFSVTPSSYQIPTSTAVNVTSTGMPTSSSSSAFPRNTRNRQTFHGKTEK
                     DKGGDDSSDEIGETPGNVSIGATGPSANNAEATIWSKLSKLTRRDHNRESMTQPVSGR
                     AGTIGASQGQQTAAALAAIREQSGPIAPGAGQVAPSLPIHEGDVKPRSLRFTWSMKTT
                     SSLAPDDMMREIRKVLDANGCDYEQRERYMILCVHGDPNTDSLVQWEMEVCKLPRLSL
                     NGVRFKRISGTSIGFKNIASKIAQELNL"
ORIGIN      
        1 atgagtggaa caaggcatgg tggagttcag atgagagctc agccgacgag tcggcaagcg
       61 acaatcagtt tattgcaacc gccgagttat aagccttcct ccaacaccac gcaaattgct
      121 caaattccgc cactattcaa tagaaactca acggcaacct catcagctgc tcaaccttca
      181 acaggaatca ccggtactcg aaagattgct gatccaaaag gacgaattcc gctcaattcg
      241 actgctgtac aaggacatcg aactgcaaca ggtgcagttg cagccaataa tggtggtatt
      301 ccaagtcatc gggatcatgc tcagcagcag cagtatatga atcaactcac ctcgtcgaca
      361 atgatgtcaa agctcatcaa taagactcca gcggctggtg gtactgcagc cacgtcatct
      421 tcttcctcat cgtctgccac gtcgacagcg ccacttcaga aatctggatc acaaatctcg
      481 cacgcaccga ctgaaccagt cattcgagaa gacgacgacg agaataacag tgagaatcag
      541 aatggaaatg ttccattgat cggaggtgtc ggaccacaaa cctctccagc tgttcaagta
      601 ccaacagaag atgcaacttc atcatcagac aaggaacaac agcagcagaa agcatccagt
      661 gagacaccca aagagtccaa gccgtcgatg atccaccaat ctccatcaat gcctccatca
      721 cagatgatga ctgcgatgga atcattgaaa ttgagcgaga gtggtcaaac ggggggaccg
      781 acagtggcga cgggaggtcc accacaacga gccacatcac agcaaatgtc tcgttcggca
      841 acaaccaata gtgcaaatat gggtgcatca tcaggaggtg ctgctgctgc tgcttctgcc
      901 acaaatcaat tatcgggtgc tccttcttct acgggtgctt ctagtcagca atatcatcca
      961 aaagctccat catcatcttc atcttcatct acaaatccac cacatcaaca tcaactaaca
     1021 cataacgcgt cgttctcggt gacaccatca tcatatcaaa ttccaacatc aacagctgtg
     1081 aacgttacct ccactggaat gccaacatca tcatcttcat cagctttccc tagaaatact
     1141 cgtaatcgac agactttcca tggaaaaacg gagaaggaca agggaggcga cgacagttct
     1201 gatgaaattg gagaaactcc gggcaatgtt tcaattggag caactggtcc atcggccaac
     1261 aatgcagaag caacaatctg gagcaaattg agcaaattga cgagacgaga tcataatcga
     1321 gaaagtatga cccagccagt atcaggacgt gctggaacca tcggagcatc acaaggacag
     1381 caaaccgcgg cggctcttgc tgcgattcgg gaacagtctg gcccaattgc tccaggtgcc
     1441 ggacaagttg caccatcgct tccgattcat gaaggagacg tcaagccacg atcattgcgg
     1501 ttcacgtgga gtatgaagac gacttcttca ttggctccgg atgatatgat gagagaaatt
     1561 cgaaaagttc ttgacgctaa cggttgtgac tacgagcaac gggaacgata catgattctg
     1621 tgtgtgcacg gtgatccgaa tacagactca cttgttcaat gggagatgga ggtctgcaag
     1681 ttgccacgtc tcagtctgaa tggagttcga ttcaaacgaa tctcgggaac atcgattggc
     1741 ttcaagaata tcgcttcgaa aatagcccaa gagctgaacc tttag
//