Dbfetch

LOCUS       NM_001269633            2118 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Serine/threonine-protein kinase par-1
            (par-1), partial mRNA.
ACCESSION   NM_001269633
VERSION     NM_001269633.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 2118)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 2118)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2118)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 2118)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..2118
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            <1..>2118
                     /gene="par-1"
                     /locus_tag="CELE_H39E23.1"
                     /db_xref="GeneID:179912"
                     /db_xref="WormBase:WBGene00003916"
     CDS             1..2118
                     /gene="par-1"
                     /locus_tag="CELE_H39E23.1"
                     /standard_name="H39E23.1h"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Serine/threonine-protein kinase par-1"
                     /protein_id="NP_001256562.1"
                     /db_xref="GeneID:179912"
                     /db_xref="WormBase:WBGene00003916"
                     /translation="MDASEITMAQSLLSHSSINVSSSLGQHPAGVITREHVTSSSASG
                     SSASPSRYSRSSATATGASITAGSALASAANAQKHQQSSAAPSSGSSSSRRSSQNDAA
                     ATAAGGTVVMSGTRHGGVQMRAQPTSRQATISLLQPPSYKPSSNTTQIAQIPPLFNRN
                     STATSSAAQPSTGITGTRKIADPKGRIPLNSTAVQGHRTATGAVAANNGGIPSHRDHA
                     QQQQYMNQLTSSTMMSKLINKTPAAGGTAATSSSSSSSATSTAPLQKSGSQISHAPTE
                     PVIREDDDENNSENQNGNVPLIGGVGPQTSPAVQVPTEDATSSSDKEQQQQKASSETP
                     KESKPSMIHQSPSMPPSQMMTAMESLKLSESGQTGGPTVATGGPPQRATSQQMSRSAT
                     TNSANMGASSGGAAAAASATNQLSGAPSSTGASSQQYHPKAPSSSSSSSTNPPHQHQL
                     THNASFSVTPSSYQIPTSTAVNVTSTGMPTSSSSSAFPRNTRNRQTFHGKTEKDKGGD
                     DSSDEIGETPGNVSIGATGPSANNAEATIWSKLSKLTRRDHNRESMTQPVSGRAGTIG
                     ASQGQQTAAALAAIREQSGPIAPGAGQVAPSLPIHEGDVKPRSLRFTWSMKTTSSLAP
                     DDMMREIRKVLDANGCDYEQRERYMILCVHGDPNTDSLVQWEMEVCKLPRLSLNGVRF
                     KRISGTSIGFKNIASKIAQELNL"
ORIGIN      
        1 atggatgcca gtgaaatcac aatggcccaa tcactgctca gccattcgtc aatcaatgtt
       61 tcgtcgtctc tgggtcagca cccggccggt gttatcacta gggagcatgt gacgtcatca
      121 tcagcgtctg gaagctctgc ttcaccatcc cgatactctc gatcctcagc aacagccaca
      181 ggtgcatcaa tcactgcagg atcagcgctc gcatcggctg cgaatgctca gaaacatcag
      241 caatcatcgg cagctccatc gtcaggatct tcgtcgtcga ggagaagctc gcaaaacgat
      301 gcggcagcga cggcggctgg tggtactgta gtgatgagtg gaacaaggca tggtggagtt
      361 cagatgagag ctcagccgac gagtcggcaa gcgacaatca gtttattgca accgccgagt
      421 tataagcctt cctccaacac cacgcaaatt gctcaaattc cgccactatt caatagaaac
      481 tcaacggcaa cctcatcagc tgctcaacct tcaacaggaa tcaccggtac tcgaaagatt
      541 gctgatccaa aaggacgaat tccgctcaat tcgactgctg tacaaggaca tcgaactgca
      601 acaggtgcag ttgcagccaa taatggtggt attccaagtc atcgggatca tgctcagcag
      661 cagcagtata tgaatcaact cacctcgtcg acaatgatgt caaagctcat caataagact
      721 ccagcggctg gtggtactgc agccacgtca tcttcttcct catcgtctgc cacgtcgaca
      781 gcgccacttc agaaatctgg atcacaaatc tcgcacgcac cgactgaacc agtcattcga
      841 gaagacgacg acgagaataa cagtgagaat cagaatggaa atgttccatt gatcggaggt
      901 gtcggaccac aaacctctcc agctgttcaa gtaccaacag aagatgcaac ttcatcatca
      961 gacaaggaac aacagcagca gaaagcatcc agtgagacac ccaaagagtc caagccgtcg
     1021 atgatccacc aatctccatc aatgcctcca tcacagatga tgactgcgat ggaatcattg
     1081 aaattgagcg agagtggtca aacgggggga ccgacagtgg cgacgggagg tccaccacaa
     1141 cgagccacat cacagcaaat gtctcgttcg gcaacaacca atagtgcaaa tatgggtgca
     1201 tcatcaggag gtgctgctgc tgctgcttct gccacaaatc aattatcggg tgctccttct
     1261 tctacgggtg cttctagtca gcaatatcat ccaaaagctc catcatcatc ttcatcttca
     1321 tctacaaatc caccacatca acatcaacta acacataacg cgtcgttctc ggtgacacca
     1381 tcatcatatc aaattccaac atcaacagct gtgaacgtta cctccactgg aatgccaaca
     1441 tcatcatctt catcagcttt ccctagaaat actcgtaatc gacagacttt ccatggaaaa
     1501 acggagaagg acaagggagg cgacgacagt tctgatgaaa ttggagaaac tccgggcaat
     1561 gtttcaattg gagcaactgg tccatcggcc aacaatgcag aagcaacaat ctggagcaaa
     1621 ttgagcaaat tgacgagacg agatcataat cgagaaagta tgacccagcc agtatcagga
     1681 cgtgctggaa ccatcggagc atcacaagga cagcaaaccg cggcggctct tgctgcgatt
     1741 cgggaacagt ctggcccaat tgctccaggt gccggacaag ttgcaccatc gcttccgatt
     1801 catgaaggag acgtcaagcc acgatcattg cggttcacgt ggagtatgaa gacgacttct
     1861 tcattggctc cggatgatat gatgagagaa attcgaaaag ttcttgacgc taacggttgt
     1921 gactacgagc aacgggaacg atacatgatt ctgtgtgtgc acggtgatcc gaatacagac
     1981 tcacttgttc aatgggagat ggaggtctgc aagttgccac gtctcagtct gaatggagtt
     2041 cgattcaaac gaatctcggg aacatcgatt ggcttcaaga atatcgcttc gaaaatagcc
     2101 caagagctga acctttag
//