Dbfetch

LOCUS       NM_001269632            3126 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Serine/threonine-protein kinase par-1
            (par-1), partial mRNA.
ACCESSION   NM_001269632
VERSION     NM_001269632.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3126)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3126)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3126)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3126)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3126
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            <1..>3126
                     /gene="par-1"
                     /locus_tag="CELE_H39E23.1"
                     /db_xref="GeneID:179912"
                     /db_xref="WormBase:WBGene00003916"
     CDS             1..3126
                     /gene="par-1"
                     /locus_tag="CELE_H39E23.1"
                     /standard_name="H39E23.1g"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Serine/threonine-protein kinase par-1"
                     /protein_id="NP_001256561.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00003916"
                     /db_xref="GeneID:179912"
                     /db_xref="WormBase:WBGene00003916"
                     /translation="MSSRSAARRNDQDVHVGKYKLLKTIGKGNFAKVKLAKHVITGHE
                     VAIKIIDKTALNPSSLQKLFREVKIMKQLDHPNIVKLYQVMETEQTLYLVLEYASGGE
                     VFDYLVAHGRMKEKEARAKFRQIVSAVQYLHSKNIIHRDLKAENLLLDQDMNIKIADF
                     GFSNTFSLGNKLDTFCGSPPYAAPELFSGKKYDGPEVDVWSLGVILYTLVSGSLPFDG
                     QNLKELRERVLRGKYRIPFYMSTDCENLLKKFLVINPQRRSSLDNIMKDRWMNVGYED
                     DELKPFIEPPKDQIDEQRIEKLIQIFQLGFNKAAILESVEKEKFEDIHATYLLLGERK
                     SDMDASEITMAQSLLSHSSINVSSSLGQHPAGVITREHVTSSSASGSSASPSRYSRSS
                     ATATGASITAGSALASAANAQKHQQSSAAPSSGSSSSRRSSQNDAAATAAGGTVVMSG
                     TRHGGVQMRAQPTSRQATISLLQPPSYKPSSNTTQIAQIPPLFNRNSTATSSAAQPST
                     GITGTRKIADPKGRIPLNSTAVQGHRTATGAVAANNGGIPSHRDHAQQQQYMNQLTSS
                     TMMSKLINKTPAAGGTAATSSSSSSSATSTAPLQKSGSQISHAPTEPVIREDDDENNS
                     ENQNGNVPLIGGVGPQTSPAVQVPTEDATSSSDKEQQQQKASSETPKESKPSMIHQSP
                     SMPPSQMMTAMESLKLSESGQTGGPTVATGGPPQRATSQQMSRSATTNSANMGASSGG
                     AAAAASATNQLSGAPSSTGASSQQYHPKAPSSSSSSSTNPPHQHQLTHNASFSVTPSS
                     YQIPTSTAVNVTSTGMPTSSSSSAFPRNTRNRQTFHGKTEKDKGGDDSSDEIGETPGN
                     VSIGATGPSANNAEATIWSKLSKLTRRDHNRESMTQPVSGRAGTIGASQGQQTAAALA
                     AIREQSGPIAPGAGQVAPSLPIHEGDVKPRSLRFTWSMKTTSSLAPDDMMREIRKVLD
                     ANGCDYEQRERYMILCVHGDPNTDSLVQWEMEVCKLPRLSLNGVRFKRISGTSIGFKN
                     IASKIAQELNL"
ORIGIN      
        1 atgtcaagtc gatcggcagc acgacgcaac gatcaggatg tacacgttgg aaagtataag
       61 ctattgaaga ctattggaaa gggaaatttt gcaaaggtaa aactcgcaaa gcacgtgata
      121 accggacatg aagtcgctat aaaaattatc gacaagactg ctctgaaccc atcgagtctt
      181 caaaaattgt tccgagaagt gaaaattatg aaacaattgg atcatccgaa tattgtgaaa
      241 ttatatcaag tgatggaaac tgaacagaca ctgtatttag tactcgaata tgcatccggt
      301 ggtgaagtat ttgattattt ggttgcacac ggaagaatga aagagaaaga agcaagagcc
      361 aaatttcgac aaattgtctc tgctgttcaa tatttgcatt cgaaaaatat aattcatcga
      421 gatttgaaag ctgaaaattt gcttctcgat caagatatga atattaaaat tgctgatttt
      481 ggattttcga ataccttctc acttggaaac aaactcgaca cattttgtgg atctccaccg
      541 tacgctgctc cagaattatt ttccggtaaa aagtacgatg gtcctgaagt agatgtttgg
      601 agtcttggtg taattctcta tactcttgta tccggaagtc taccatttga tggacaaaat
      661 ttgaaagagc ttcgagaacg tgtgctccgt ggaaaatacc gtatcccgtt ctatatgtca
      721 acggattgtg agaatttgtt gaagaaattc cttgttatca atccacaaag gagatcatca
      781 ttggataata ttatgaaaga tcgatggatg aatgtgggat atgaagatga tgagcttaag
      841 ccatttattg agccaccaaa agatcaaatt gatgaacaga gaattgagaa attgattcag
      901 atcttccaac tcggattcaa caaagccgcc attttggaaa gcgtcgagaa ggaaaagttt
      961 gaagatattc atgcaacgta tttgctttta ggagaacgaa aatctgatat ggatgccagt
     1021 gaaatcacaa tggcccaatc actgctcagc cattcgtcaa tcaatgtttc gtcgtctctg
     1081 ggtcagcacc cggccggtgt tatcactagg gagcatgtga cgtcatcatc agcgtctgga
     1141 agctctgctt caccatcccg atactctcga tcctcagcaa cagccacagg tgcatcaatc
     1201 actgcaggat cagcgctcgc atcggctgcg aatgctcaga aacatcagca atcatcggca
     1261 gctccatcgt caggatcttc gtcgtcgagg agaagctcgc aaaacgatgc ggcagcgacg
     1321 gcggctggtg gtactgtagt gatgagtgga acaaggcatg gtggagttca gatgagagct
     1381 cagccgacga gtcggcaagc gacaatcagt ttattgcaac cgccgagtta taagccttcc
     1441 tccaacacca cgcaaattgc tcaaattccg ccactattca atagaaactc aacggcaacc
     1501 tcatcagctg ctcaaccttc aacaggaatc accggtactc gaaagattgc tgatccaaaa
     1561 ggacgaattc cgctcaattc gactgctgta caaggacatc gaactgcaac aggtgcagtt
     1621 gcagccaata atggtggtat tccaagtcat cgggatcatg ctcagcagca gcagtatatg
     1681 aatcaactca cctcgtcgac aatgatgtca aagctcatca ataagactcc agcggctggt
     1741 ggtactgcag ccacgtcatc ttcttcctca tcgtctgcca cgtcgacagc gccacttcag
     1801 aaatctggat cacaaatctc gcacgcaccg actgaaccag tcattcgaga agacgacgac
     1861 gagaataaca gtgagaatca gaatggaaat gttccattga tcggaggtgt cggaccacaa
     1921 acctctccag ctgttcaagt accaacagaa gatgcaactt catcatcaga caaggaacaa
     1981 cagcagcaga aagcatccag tgagacaccc aaagagtcca agccgtcgat gatccaccaa
     2041 tctccatcaa tgcctccatc acagatgatg actgcgatgg aatcattgaa attgagcgag
     2101 agtggtcaaa cggggggacc gacagtggcg acgggaggtc caccacaacg agccacatca
     2161 cagcaaatgt ctcgttcggc aacaaccaat agtgcaaata tgggtgcatc atcaggaggt
     2221 gctgctgctg ctgcttctgc cacaaatcaa ttatcgggtg ctccttcttc tacgggtgct
     2281 tctagtcagc aatatcatcc aaaagctcca tcatcatctt catcttcatc tacaaatcca
     2341 ccacatcaac atcaactaac acataacgcg tcgttctcgg tgacaccatc atcatatcaa
     2401 attccaacat caacagctgt gaacgttacc tccactggaa tgccaacatc atcatcttca
     2461 tcagctttcc ctagaaatac tcgtaatcga cagactttcc atggaaaaac ggagaaggac
     2521 aagggaggcg acgacagttc tgatgaaatt ggagaaactc cgggcaatgt ttcaattgga
     2581 gcaactggtc catcggccaa caatgcagaa gcaacaatct ggagcaaatt gagcaaattg
     2641 acgagacgag atcataatcg agaaagtatg acccagccag tatcaggacg tgctggaacc
     2701 atcggagcat cacaaggaca gcaaaccgcg gcggctcttg ctgcgattcg ggaacagtct
     2761 ggcccaattg ctccaggtgc cggacaagtt gcaccatcgc ttccgattca tgaaggagac
     2821 gtcaagccac gatcattgcg gttcacgtgg agtatgaaga cgacttcttc attggctccg
     2881 gatgatatga tgagagaaat tcgaaaagtt cttgacgcta acggttgtga ctacgagcaa
     2941 cgggaacgat acatgattct gtgtgtgcac ggtgatccga atacagactc acttgttcaa
     3001 tgggagatgg aggtctgcaa gttgccacgt ctcagtctga atggagttcg attcaaacga
     3061 atctcgggaa catcgattgg cttcaagaat atcgcttcga aaatagccca agagctgaac
     3121 ctttag
//